The URL can be used to link to this page

Home My WebLink AboutReso 118-2023 (23-540)800 Dubuque Avenue Project Initial Study/MND Errata ERRATA for the 800 Dubuque Avenue Project Initial Study and Mitigated Negative Declaration State Clearinghouse Number: 2023030721 PURPOSE OF THIS ERRATA SHEET This errata sheet is intended to be appended to the Initial Study and Mitigated Negative Declaration (IS/MND) for the proposed 800 Dubuque Avenue Project (project). The revisions in this document are not “substantial revisions” that could trigger recirculation of the IS/MND or preparation of an environmental impact report under CEQA Guidelines sections 15073.5 and 15074.1. No new significant effects are identified, no new mitigation measures are added, the significance of identified impacts remains unchanged, and all impacts are either below significance levels or reduced to that level through application of identified mitigation. REVISIONS TO THE IS/MND The following are minor text changes, additions, or modifications made to the IS/MND. A page number from the IS/MND and explanation of each revision is included in italics preceding each revision. Existing and revised IS/MND text is indented. Deletions are noted by strikethrough; additions are underlined. Page 45: The following clarifications to the project site’s location in a zone of required investigation for liquefaction were informed by the comments from the California Geologic Survey. Per the California Geological Survey’s Earthquake Zones of Required Investigation map Tthe project site is not within a mapped liquefaction hazard zone, indicating the need for a site-specific investigation.15 but Tthe project’s Geotechnical Investigation assessed the potential for liquefaction given the characteristics of the site soils. 15 California Geological Survey, Earthquake Zones of Required Investigation, available at https://maps.conservation.ca.gov/cgs/EQZApp/app/ Page 57: The following clarifications to the airport-related height constraints and approval process were informed by the comments from the San Francisco International Airport (SFO). Errata 800 Dubuque Avenue Project Initial Study/MND Development on the project site is limited to maximum heights below the critical aeronautical surface, which is of 261 approximately 860 feet above mean sea level. Additionally, the Federal Aviation Administration (FAA) identifies obstruction evaluation surfaces at the site at a height of 261 feet above mean sea level. Penetrations above this level (for construction equipment and/or permanent structures) are not necessarily considered hazards to air navigation, and higher structures but could be modified permitted through consultation with the Federal Aviation Administration (FAA).18 Factoring in the height of the site, the applicant estimates that the proposed project would reach a maximum heights of about 218 feet above mean sea level plus additional rooftop elements, all of which would be below the critical aeronautical surfaces. the lowest FAA height limits at the site of 261 feet. The project is consistent with airport-related building safety policies identified in the ALUCP. Notification and consultation with Review by the FAA would be required under CFR part 77.9 for both permanent structures and temporary cranes or other equipment above obstruction evaluation heights, as applicable. and would ensure that the project is compatible with the SFO ALUCP. Therefore, this impact would be less than significant. INITIAL STUDY AND MITIGATED NEGATIVE DECLARATION 800DUBUQUE AVENUE PROJECT Lead Agency: City of South San Francisco Economic & Community Development Department 315 Maple Avenue South San Francisco, CA 94083-0711 MARCH 2023 Prepared By: Lamphier-Gregory, Inc. 4100 Redwood Rd, STE 20A - #601 Oakland, CA 94619 >DW,/ZͲ'Z'KZzϰϭϬϬZtKKZK͕^dϮϬͲηϲϬϭK<>E͕ϵϰϲϭϵ LAMPHIER-GREGORY MEMO dK͗ ŚƌŝƐƚŽƉŚĞƌƐƉŝƌŝƚƵ͕^ĞŶŝŽƌWůĂŶŶĞƌ ŝƚǇŽĨ^ŽƵƚŚ^ĂŶ&ƌĂŶĐŝƐĐŽ ĐŽŶŽŵŝĐĂŶĚŽŵŵƵŶŝƚǇĞǀĞůŽƉŵĞŶƚĞƉĂƌƚŵĞŶƚ ϯϭϱDĂƉůĞǀĞŶƵĞ ^ŽƵƚŚ^ĂŶ&ƌĂŶĐŝƐĐŽ͕ϵϰϬϴϬ &ZKD͗ ZĞďĞĐĐĂƵůĚ͕sŝĐĞWƌĞƐŝĚĞŶƚ >ĂŵƉŚŝĞƌͲ'ƌĞŐŽƌǇ͕/ŶĐ͘ ^h:d͗ϴϬϬƵďƵƋƵĞǀĞŶƵĞWƌŽũĞĐƚ/^ͬDEʹZĞǀŝĞǁĂŶĚŝƐĐƵƐƐŝŽŶŽĨŽŵŵĞŶƚƐ d͗ :ƵŶĞϭ͕ϮϬϮϯ PURPOSE OF THIS MEMO dŚŝƐŵĞŵŽƉƌŽǀŝĚĞƐĂďƌŝĞĨĚŝƐĐƵƐƐŝŽŶŽĨĐŽŵŵĞŶƚƐƌĞĐĞŝǀĞĚŝŶƌĞƐƉŽŶƐĞƚŽƚŚĞ/ŶŝƚŝĂů^ƚƵĚǇͬDŝƚŝŐĂƚĞĚ EĞŐĂƚŝǀĞĞĐůĂƌĂƚŝŽŶ;͞/^ͬDE͟ͿĨŽƌƚŚĞϴϬϬƵďƵƋƵĞǀĞŶƵĞWƌŽũĞĐƚ;͞ƉƌŽũĞĐƚ͟Ϳ͘dŚŽƵŐŚƚŚĞĂůŝĨŽƌŶŝĂ ŶǀŝƌŽŶŵĞŶƚĂůYƵĂůŝƚǇĐƚ;͞Y͟ͿĚŽĞƐŶŽƚƌĞƋƵŝƌĞĂůĞĂĚĂŐĞŶĐǇƚŽĨŽƌŵĂůůǇƌĞƐƉŽŶĚƚŽǁƌŝƚƚĞŶ ĐŽŵŵĞŶƚƐƌĞĐĞŝǀĞĚŽŶĂŶ/^ͬDE͕ƚŚŝƐŵĞŵŽƌĂŶĚƵŵŝƐďĞŝŶŐƉƌŽǀŝĚĞĚďǇƚŚĞ/^ͬDEƉƌĞƉĂƌĞƌƚŽ ĚĞŵŽŶƐƚƌĂƚĞƚŚĂƚƚŚĞĐŽŵŵĞŶƚƐĚŽŶŽƚƉƌĞƐĞŶƚƐƵďƐƚĂŶƚŝĂůĞǀŝĚĞŶĐĞƐƵƉƉŽƌƚŝŶŐĂĨĂŝƌĂƌŐƵŵĞŶƚƚŚĂƚ ƚŚĞƉƌŽũĞĐƚŵĂǇŚĂǀĞĂƐŝŐŶŝĨŝĐĂŶƚĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚ͕ŽƌƚŚĂƚƚŚĞ/^ͬDEƐŚŽƵůĚďĞƌĞǀŝƐĞĚĂŶĚ ƌĞĐŝƌĐƵůĂƚĞĚĨŽƌƉƵďůŝĐƌĞǀŝĞǁ͘ ƐĞƉĂƌĂƚĞĞƌƌĂƚĂƐŚĞĞƚŚĂƐĂůƐŽďĞĞŶƉƌĞƉĂƌĞĚƚŽĂĚĚƌĞƐƐŵŝŶŽƌĐŽƌƌĞĐƚŝŽŶƐĂŶĚĐůĂƌŝĨŝĐĂƚŝŽŶƐŝŶĨŽƌŵĞĚ ďǇƚŚĞĐŽŵŵĞŶƚƐƌĞĐĞŝǀĞĚĂƐŶŽƚĞĚŝŶƚŚĞƌĞƐƉŽŶƐĞƚŽĐŽŵŵĞŶƚƐďĞůŽǁĂŶĚŝŶĐůƵĚĞĚŝŶƚŚĞĐŽŶĐůƵƐŝŽŶƐ ŝŶƚŚŝƐĚŽĐƵŵĞŶƚ͘dŚĞĞƌƌĂƚĂƐŚĞĞƚǁŝůůďĞĂƉƉĞŶĚĞĚƚŽƚŚĞ/^ͬDE͘ SUMMARY CONCLUSIONS /ŶƐƵŵŵĂƌǇ͕ƚŚĞůĞƚƚĞƌƐŚĂǀĞŶŽƚƌĂŝƐĞĚĂŶǇŝƐƐƵĞƐƚŚĂƚǁŽƵůĚƌĞƋƵŝƌĞƌĞĐŝƌĐƵůĂƚŝŽŶŽĨƚŚĞ/^ͬDEŽƌ ƉƌĞƉĂƌĂƚŝŽŶŽĨĂŶĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚƌĞƉŽƌƚƵŶĚĞƌƐĞĐƚŝŽŶƐϭϱϬϳϯ͘ϱĂŶĚϭϱϬϳϰ͘ϭŽĨƚŚĞY 'ƵŝĚĞůŝŶĞƐĂƐŶŽŶĞǁƐŝŐŶŝĨŝĐĂŶƚĞĨĨĞĐƚƐǁĞƌĞŝĚĞŶƚŝĨŝĞĚ͕ŶŽŶĞǁŵŝƚŝŐĂƚŝŽŶŵĞĂƐƵƌĞƐǁĞƌĞĂĚĚĞĚ͕ƚŚĞ ƐŝŐŶŝĨŝĐĂŶĐĞŽĨŝĚĞŶƚŝĨŝĞĚŝŵƉĂĐƚƐƌĞŵĂŝŶƐƵŶĐŚĂŶŐĞĚ͕ĂŶĚĂůůŝŵƉĂĐƚƐĂƌĞĞŝƚŚĞƌďĞůŽǁƐŝŐŶŝĨŝĐĂŶĐĞůĞǀĞůƐ ŽƌƌĞĚƵĐĞĚƚŽƚŚĂƚůĞǀĞůƚŚƌŽƵŐŚĂƉƉůŝĐĂƚŝŽŶŽĨŝĚĞŶƚŝĨŝĞĚŵŝƚŝŐĂƚŝŽŶ͘ COMMENTS RECEIVED dŚĞĐŽŵŵĞŶƚƉĞƌŝŽĚƌĂŶĨƌŽŵDĂƌĐŚϮϵ͕ϮϬϮϯ͕ƚŚƌŽƵŐŚƉƌŝůϮϳ͕ϮϬϮϯ͘ŽŵŵĞŶƚůĞƚƚĞƌƐǁĞƌĞƌĞĐĞŝǀĞĚ ĨƌŽŵƚŚƌĞĞĂŐĞŶĐŝĞƐĚƵƌŝŶŐƚŚĞĐŽŵŵĞŶƚƉĞƌŝŽĚ͕ĂƐůŝƐƚĞĚďĞůŽǁ͘ ϲͬϭͬϮϯ W'ϮŽĨϯ >DW,/ZͲ'Z'KZzϰϭϬϬZtKKZK͕^dϮϬͲηϲϬϭK<>E͕ϵϰϲϭϵ x WĂĐŝĨŝĐ'ĂƐĂŶĚůĞĐƚƌŝĐŽŵƉĂŶǇ>ĞƚƚĞƌƐ͗WůĂŶZĞǀŝĞǁdĞĂŵĂŶĚ:ƵƐƚŝŶEĞǁĞůů͕>ĂŶĚ DĂŶĂŐĞŵĞŶƚ͕ĚĂƚĞĚDĂƌĐŚϮϵĂŶĚƉƌŝůϮϱ͕ϮϬϮϯ x ^ĂŶ&ƌĂŶĐŝƐĐŽ/ŶƚĞƌŶĂƚŝŽŶĂůŝƌƉŽƌƚ>ĞƚƚĞƌ͗EƵƉƵƌ^ŝŶŚĂ͕ŝƌĞĐƚŽƌŽĨWůĂŶŶŝŶŐĂŶĚŶǀŝƌŽŶŵĞŶƚĂů ĨĨĂŝƌƐ͕ĚĂƚĞĚƉƌŝůϭϴ͕ϮϬϮϯ x ĂůŝĨŽƌŶŝĂ'ĞŽůŽŐŝĐ^ƵƌǀĞǇ͗ƌ͘ƌŝŬ&ƌŽƐƚ͕^ĞŶŝŽƌŶŐŝŶĞĞƌŝŶŐ'ĞŽůŽŐŝƐƚ͕ĞŵĂŝůƐĞŶƚƉƌŝůϮϱ͕ϮϬϮϯ DISCUSSION OF COMMENT LETTERS WĂĐŝĨŝĐ'ĂƐĂŶĚůĞĐƚƌŝĐŽŵƉĂŶǇ dŚĞDĂƌĐŚůĞƚƚĞƌĐůĂƌŝĨŝĞƐW'ΘƉŽůŝĐŝĞƐĂŶĚƉƌŽĐĞĚƵƌĞƐŝŶƚŚĞĞǀĞŶƚW'ΘŽǁŶĞĚƉƌŽƉĞƌƚŝĞƐĂŶĚͬŽƌ ĞĂƐĞŵĞŶƚƐĂƌĞŽŶŽƌĂĚũĂĐĞŶƚƚŽƚŚĞƉƌŽũĞĐƚƐŝƚĞ͕ŝŶĐůƵĚŝŶŐŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚƚŚĞW'ΘƌĞǀŝĞǁƉƌŽĐĞƐƐ͕ ƐĂĨĞƚǇƉƌŽĐĞĚƵƌĞƐƌĞůĂƚĞĚƚŽĐŽŶƐƚƌƵĐƚŝŽŶŶĞĂƌŐĂƐƚƌĂŶƐŵŝƐƐŝŽŶƉŝƉĞůŝŶĞƐ͕ĂŶĚĞǆĂŵƉůĞƐĂŶĚƌĞƐƚƌŝĐƚŝŽŶƐ ĨŽƌĞǆƚĞƌŶĂůƵƐĞƐǁŝƚŚŝŶĞůĞĐƚƌŝĐƚƌĂŶƐŵŝƐƐŝŽŶĨĞĞƐƚƌŝƉƐĂŶĚͬŽƌĞĂƐĞŵĞŶƚƐ͘dŚĞƉƌŽũĞĐƚǁŽƵůĚďĞ ƌĞƋƵŝƌĞĚƚŽĨŽůůŽǁĂƉƉůŝĐĂďůĞW'ΘƌĞƋƵŝƌĞŵĞŶƚƐĂŶĚƉƌŽĐĞĚƵƌĞƐǁŚĞŶĚĞƚĞƌŵŝŶĞĚƚŽďĞĂƉƉůŝĐĂďůĞ͘ dŚĞƐĞĐŽŵŵĞŶƚƐĚŽŶŽƚƌĞĨĞƌĞŶĐĞŽƌƐƉĞĐŝĨŝĐĂůůǇƌĞůĂƚĞƚŽƚŚĞĂĚĞƋƵĂĐǇŽĨƚŚĞĂŶĂůǇƐŝƐŝŶƚŚĞ/^ͬDE ĂŶĚŶŽƌĞǀŝƐŝŽŶƐƚŽƚŚĞ/^ͬDEĂƌĞŶĞĐĞƐƐĂƌǇƚŽĂĚĚƌĞƐƐƚŚŝƐĐŽŵŵĞŶƚ͘dŚĞƐĞƉƌŽĐĞĚƵƌĂůƌĞŵŝŶĚĞƌƐ ŚĂǀĞďĞĞŶƉƌŽǀŝĚĞĚƚŽŝƚǇƐƚĂĨĨĂŶĚƚŚĞĂƉƉůŝĐĂŶƚ͘ dŚĞƉƌŝůůĞƚƚĞƌƉƌŽǀŝĚĞƐĨƵƌƚŚĞƌŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚƉƌŽĐĞĚƵƌĞƐŝŶƚŚĞĞǀĞŶƚŽĨƌĞůŽĐĂƚŝŽŶŽƌŵŽĚŝĨŝĐĂƚŝŽŶ ŽĨĞǆŝƐƚŝŶŐŐĂƐĂŶĚĞůĞĐƚƌŝĐƐĞƌǀŝĐĞƐ͘ EĞŝƚŚĞƌůĞƚƚĞƌŝƐĂĐŽŵŵĞŶƚŽŶƚŚĞĞŶǀŝƌŽŶŵĞŶƚĂůĂŶĂůǇƐŝƐĂŶĚĚŽŶŽƚƌĞƋƵŝƌĞƌĞĐŝƌĐƵůĂƚŝŽŶŽĨƚŚĞ /^ͬDEŽƌƉƌĞƉĂƌĂƚŝŽŶŽĨĂŶĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚƌĞƉŽƌƚƵŶĚĞƌƐĞĐƚŝŽŶϭϱϬϳϯ͘ϱŽĨƚŚĞY 'ƵŝĚĞůŝŶĞƐ͘ ^ĂŶ&ƌĂŶĐŝƐĐŽ/ŶƚĞƌŶĂƚŝŽŶĂůŝƌƉŽƌƚ dŚŝƐůĞƚƚĞƌĐŽŶĨŝƌŵƐĂŶĚĐůĂƌŝĨŝĞƐƚŚĞƌĞŐƵůĂƚŝŽŶƐƐƉĞĐŝĨŝĐƚŽƚŚŝƐƐŝƚĞŝŶƌĞŐĂƌĚƐƚŽŝƚƐƉƌŽǆŝŵŝƚǇƚŽƚŚĞ^ĂŶ &ƌĂŶĐŝƐĐŽ/ŶƚĞƌŶĂƚŝŽŶĂůŝƌƉŽƌƚ;^&KͿ͘ dŚĞůĞƚƚĞƌĂŐƌĞĞƐǁŝƚŚĐŽŶĐůƵƐŝŽŶƐŝŶƚŚĞ/^ͬDEƌĞůĂƚĞĚƚŽĂŝƌƉŽƌƚŶŽŝƐĞĂŶĚŚĂǌĂƌĚƐ;ĚŝƐĐƵƐƐĞĚŽŶ /^ͬDEƉĂŐĞƐϱϳĂŶĚϲϳͿ͘ůĂƌŝĨŝĐĂƚŝŽŶƐƚŽƚŚĞĂƉƉƌŽǀĂůƉƌŽĐĞƐƐĂŶĚĂůůŽǁĂďůĞŚĞŝŐŚƚƐŚĂǀĞďĞĞŶĂĚĚĞĚ ƚŽƚŚĞĞƌƌĂƚĂƐŚĞĞƚ͘dŚĞůĞƚƚĞƌĂůƐŽŶŽƚĞƐƚŚĂƚĚĞƉĂƌƚŝŶŐƉůĂŶĞƐǁŽƵůĚĂƐĐĞŶĚŽǀĞƌƚŚĞƉƌŽũĞĐƚƐŝƚĞ͕ǁŚŝĐŚ ŵĂǇĞǆƉĞƌŝĞŶĐĞƐŽŵĞĂŝƌĐƌĂĨƚĚĞƉĂƌƚƵƌĞŶŽŝƐĞĚŝƐƚƵƌďĂŶĐĞ͕ƉĂƌƚŝĐƵůĂƌůǇŽǀĞƌŶŝŐŚƚ͘ŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞ ĐŽŶĐůƵƐŝŽŶƐŽĨƚŚĞ/^ͬDE͕ƚŚĞůĞƚƚĞƌĂůƐŽŝŶĚŝĐĂƚĞƐƚŚĂƚƚŚĞƉƌŽũĞĐƚƐŝƚĞŝƐůŽĐĂƚĞĚŽƵƚƐŝĚĞƚŚĞϲϱĚĞĐŝďĞů ĐŽŶƚŽƵƌ͕ĂŶĚŶŽŝƐĞůĞǀĞůƐǁŽƵůĚŶŽƚďĞŝŶĐŽŶƐŝƐƚĞŶƚǁŝƚŚƚŚĞƉƌŽƉŽƐĞĚƵƐĞ͘ dŚŝƐŝŶĨŽƌŵĂƚŝŽŶĚŽĞƐŶŽƚƌĞƐƵůƚŝŶŶĞǁƐŝŐŶŝĨŝĐĂŶƚŝŵƉĂĐƚƐŽƌŵŝƚŝŐĂƚŝŽŶŵĞĂƐƵƌĞƐ͕ŽƌĐŚĂŶŐĞĚŝŵƉĂĐƚ ĐŽŶĐůƵƐŝŽŶƐ͘dŚĞĐŽŵŵĞŶƚƐŝŶƚŚŝƐůĞƚƚĞƌ͕ƚŚŝƐƌĞƐƉŽŶƐĞ͕ĂŶĚƚŚĞƌĞůĂƚĞĚĞƌƌĂƚĂĚŽŶŽƚƌĞƋƵŝƌĞ ƌĞĐŝƌĐƵůĂƚŝŽŶŽĨƚŚĞ/^ͬDEŽƌƉƌĞƉĂƌĂƚŝŽŶŽĨĂŶĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚƌĞƉŽƌƚƵŶĚĞƌƐĞĐƚŝŽŶϭϱϬϳϯ͘ϱŽĨ ƚŚĞY'ƵŝĚĞůŝŶĞƐ͘ ĂůŝĨŽƌŶŝĂ'ĞŽůŽŐŝĐ^ƵƌǀĞǇ dŚŝƐůĞƚƚĞƌĐůĂƌŝĨŝĞƐƚŚĂƚƚŚĞƉƌŽũĞĐƚƐŝƚĞŝƐŝŶĂǌŽŶĞŽĨƌĞƋƵŝƌĞĚŝŶǀĞƐƚŝŐĂƚŝŽŶĨŽƌůŝƋƵĞĨĂĐƚŝŽŶ;ĚŝƐĐƵƐƐĞĚ ŽŶ/^ͬDEƉĂŐĞϰϱͿ͕ĂŶĚĂůƐŽŶŽƚĞƐƚŚĂƚƚŚĞƌĞƋƵŝƌĞĚŝŶǀĞƐƚŝŐĂƚŝŽŶǁĂƐĐŽŵƉůĞƚĞĚďǇƚŚĞƉƌŽũĞĐƚ͛Ɛ 'ĞŽƚĞĐŚŶŝĐĂů/ŶǀĞƐƚŝŐĂƚŝŽŶĂƐƉƌĞƐĞŶƚĞĚŝŶƚŚĞ/^ͬDE͘ůĂƌŝĨŝĐĂƚŝŽŶƐƚŽƚŚĞƉƌŽũĞĐƚ͛ƐůŽĐĂƚŝŽŶŝŶĂ ŵĂƉƉĞĚůŝƋƵĞĨĂĐƚŝŽŶŚĂǌĂƌĚǌŽŶĞŚĂǀĞďĞĞŶĂĚĚĞĚƚŽƚŚĞĞƌƌĂƚĂƐŚĞĞƚ͘ ϲͬϭͬϮϯ W'ϯŽĨϯ >DW,/ZͲ'Z'KZzϰϭϬϬZtKKZK͕^dϮϬͲηϲϬϭK<>E͕ϵϰϲϭϵ dŚŝƐŝŶĨŽƌŵĂƚŝŽŶĚŽĞƐŶŽƚƌĞƐƵůƚŝŶŶĞǁƐŝŐŶŝĨŝĐĂŶƚŝŵƉĂĐƚƐŽƌŵŝƚŝŐĂƚŝŽŶŵĞĂƐƵƌĞƐŽƌĐŚĂŶŐĞĚŝŵƉĂĐƚ ĐŽŶĐůƵƐŝŽŶƐ͘dŚĞĐŽŵŵĞŶƚƐŝŶƚŚŝƐůĞƚƚĞƌĂŶĚƚŚŝƐƌĞƐƉŽŶƐĞĚŽŶŽƚƌĞƋƵŝƌĞƌĞĐŝƌĐƵůĂƚŝŽŶŽĨƚŚĞ/^ͬDEŽƌ ƉƌĞƉĂƌĂƚŝŽŶŽĨĂŶĞŶǀŝƌŽŶŵĞŶƚĂůŝŵƉĂĐƚƌĞƉŽƌƚƵŶĚĞƌƐĞĐƚŝŽŶϭϱϬϳϯ͘ϱŽĨƚŚĞY'ƵŝĚĞůŝŶĞƐ͘ Plan Review Team Land Management PGEPlanReview@pge.com PG&E Gas and Electric Facilities Page 1 Public March 29, 2023 Kelsey Evans City of South San Francisco 315 Maple Ave South San Francisco, CA 94080 Ref: Gas and Electric Transmission and Distribution Dear Kelsey Evans, Thank you for submitting the 800 Dubuque Ave plans for our review. PG&E will review the submitted plans in relationship to any existing Gas and Electric facilities within the project area. If the proposed project is adjacent/or within PG&E owned property and/or easements, we will be working with you to ensure compatible uses and activities near our facilities. Attached you will find information and requirements as it relates to Gas facilities (Attachment 1) and Electric facilities (Attachment 2). Please review these in detail, as it is critical to ensure your safety and to protect PG&E’s facilities and its existing rights. Below is additional information for your review: 1. This plan review process does not replace the application process for PG&E gas or electric service your project may require. For these requests, please continue to work with PG&E Service Planning: https://www.pge.com/en_US/business/services/building- and-renovation/overview/overview.page. 2. If the project being submitted is part of a larger project, please include the entire scope of your project, and not just a portion of it. PG&E’s facilities are to be incorporated within any CEQA document. PG&E needs to verify that the CEQA document will identify any required future PG&E services. 3. An engineering deposit may be required to review plans for a project depending on the size, scope, and location of the project and as it relates to any rearrangement or new installation of PG&E facilities. Any proposed uses within the PG&E fee strip and/or easement, may include a California Public Utility Commission (CPUC) Section 851 filing. This requires the CPUC to render approval for a conveyance of rights for specific uses on PG&E’s fee strip or easement. PG&E will advise if the necessity to incorporate a CPUC Section 851filing is required. This letter does not constitute PG&E’s consent to use any portion of its easement for any purpose not previously conveyed. PG&E will provide a project specific response as required. Sincerely, Plan Review Team Land Management ϴϬϬhhYhsEhWZK:dͲDDZWW'ϭK&ϭϬ800 Dubuque Avenue Project Mitigation Monitoring and Reporting Program DŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚŝƌYƵĂůŝƚǇ'ĞŶĞƌĂůWůĂŶDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞ'WͲDDͲŝƌͲϭĂ͗ĂƐŝĐŽŶƐƚƌƵĐƚŝŽŶDĂŶĂŐĞŵĞŶƚWƌĂĐƚŝĐĞƐ͘΀dŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚͬŽǁŶĞƌͬƐƉŽŶƐŽƌ΁ƐŚĂůůŝŶĐŽƌƉŽƌĂƚĞƚŚĞĨŽůůŽǁŝŶŐĂƐŝĐŽŶƐƚƌƵĐƚŝŽŶDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞƐƌĞĐŽŵŵĞŶĚĞĚďǇƚŚĞĂǇƌĞĂŝƌYƵĂůŝƚǇDĂŶĂŐĞŵĞŶƚŝƐƚƌŝĐƚ;YDͿ͗ŝͿ ůůĞǆƉŽƐĞĚƐƵƌĨĂĐĞƐ;Ğ͘Ő͕͘ƉĂƌŬŝŶŐĂƌĞĂƐ͕ƐƚĂŐŝŶŐĂƌĞĂƐ͕ƐŽŝůƉŝůĞƐ͕ŐƌĂĚĞĚĂƌĞĂƐ͕ĂŶĚƵŶƉĂǀĞĚĂĐĐĞƐƐƌŽĂĚƐͿƐŚĂůůďĞǁĂƚĞƌĞĚƚǁŽƚŝŵĞƐƉĞƌĚĂǇ͘ŝŝͿ ůůŚĂƵůƚƌƵĐŬƐƚƌĂŶƐƉŽƌƚŝŶŐƐŽŝů͕ƐĂŶĚ͕ŽƌŽƚŚĞƌůŽŽƐĞŵĂƚĞƌŝĂůŽĨĨͲƐŝƚĞƐŚĂůůďĞĐŽǀĞƌĞĚ͘ŝŝŝͿ ůůǀŝƐŝďůĞŵƵĚŽƌĚŝƌƚƚƌĂĐŬŽƵƚŽŶƚŽĂĚũĂĐĞŶƚƉƵďůŝĐƌŽĂĚƐƐŚĂůůďĞƌĞŵŽǀĞĚƵƐŝŶŐǁĞƚƉŽǁĞƌǀĂĐƵƵŵƐƚƌĞĞƚƐǁĞĞƉĞƌƐĂƚůĞĂƐƚŽŶĐĞƉĞƌĚĂǇ͘dŚĞƵƐĞŽĨĚƌǇƉŽǁĞƌƐǁĞĞƉŝŶŐŝƐƉƌŽŚŝďŝƚĞĚ͘ŝǀͿ ůůǀĞŚŝĐůĞƐƉĞĞĚƐŽŶƵŶƉĂǀĞĚƌŽĂĚƐƐŚĂůůďĞůŝŵŝƚĞĚƚŽϭϱŵƉŚ͘ǀͿ ůůƌŽĂĚǁĂǇƐ͕ĚƌŝǀĞǁĂǇƐ͕ĂŶĚƐŝĚĞǁĂůŬƐƚŽďĞƉĂǀĞĚƐŚĂůůďĞĐŽŵƉůĞƚĞĚĂƐƐŽŽŶĂƐƉŽƐƐŝďůĞ͘ƵŝůĚŝŶŐƉĂĚƐƐŚĂůůďĞůĂŝĚĂƐƐŽŽŶĂƐƉŽƐƐŝďůĞĂĨƚĞƌŐƌĂĚŝŶŐƵŶůĞƐƐƐĞĞĚŝŶŐŽƌƐŽŝůďŝŶĚĞƌƐĂƌĞƵƐĞĚ͘WƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨĂůůŐƌĂĚŝŶŐĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶƉĞƌŵŝƚƐͲĂŶĚͲƵƌŝŶŐŐƌĂĚŝŶŐĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐƉƌŽǀŝĚĞĂĐŬŶŽǁůĞĚŐŵĞŶƚŽĨƌĞƋƵŝƌĞŵĞŶƚƐͲĂŶĚͲsĞƌŝĨǇƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞŵĞƚĚƵƌŝŶŐŐƌĂĚŝŶŐĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶ^^&ƵŝůĚŝŶŐŝǀŝƐŝŽŶ DŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞŝƌͲϮ͗ZĞĚƵĐĞŝĞƐĞůWĂƌƚŝĐƵůĂƚĞDĂƚƚĞƌƵƌŝŶŐŽŶƐƚƌƵĐƚŝŽŶ͘dŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚͬŽǁŶĞƌͬƐƉŽŶƐŽƌƐŚĂůůŝŵƉůĞŵĞŶƚĂĨĞĂƐŝďůĞƉůĂŶƚŽƌĞĚƵĐĞWDĞŵŝƐƐŝŽŶƐďǇĂƚůĞĂƐƚϱϬƉĞƌĐĞŶƚƐƵĐŚƚŚĂƚŝŶĐƌĞĂƐĞĚĐĂŶĐĞƌƌŝƐŬĂŶĚĂŶŶƵĂůWDϮ͘ϱĐŽŶĐĞŶƚƌĂƚŝŽŶƐĨƌŽŵĐŽŶƐƚƌƵĐƚŝŽŶǁŽƵůĚďĞƌĞĚƵĐĞĚďĞůŽǁdƐŝŐŶŝĨŝĐĂŶĐĞůĞǀĞůƐĂƐĨŽůůŽǁƐ͗ϭ͘ůůĐŽŶƐƚƌƵĐƚŝŽŶĞƋƵŝƉŵĞŶƚůĂƌŐĞƌƚŚĂŶϮϱŚŽƌƐĞƉŽǁĞƌƵƐĞĚĂƚƚŚĞƐŝƚĞĨŽƌŵŽƌĞƚŚĂŶƚǁŽĐŽŶƚŝŶƵŽƵƐĚĂǇƐŽƌϮϬŚŽƵƌƐƚŽƚĂůƐŚĂůůŵĞĞƚh͘^͘WdŝĞƌϰĞŵŝƐƐŝŽŶƐƚĂŶĚĂƌĚƐĨŽƌWD;WDϭϬĂŶĚWDϮ͘ϱͿ͕ŝĨĨĞĂƐŝďůĞ͕ŽƚŚĞƌǁŝƐĞ͕Ă͘/ĨƵƐĞŽĨdŝĞƌϰĞƋƵŝƉŵĞŶƚŝƐŶŽƚĂǀĂŝůĂďůĞ͕ĂůƚĞƌŶĂƚŝǀĞůǇƵƐĞWƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨĂůůŐƌĂĚŝŶŐĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶƉĞƌŵŝƚƐͲĂŶĚͲƵƌŝŶŐŐƌĂĚŝŶŐĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐƉƌŽǀŝĚĞĂĐŬŶŽǁůĞĚŐŵĞŶƚŽĨƌĞƋƵŝƌĞŵĞŶƚƐͲĂŶĚͲsĞƌŝĨǇƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞŵĞƚĚƵƌŝŶŐŐƌĂĚŝŶŐĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶ^^&ƵŝůĚŝŶŐŝǀŝƐŝŽŶ W'ϮK&ϭϬ ϴϬϬhhYhsEhWZK:dͲDDZW DŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚĞƋƵŝƉŵĞŶƚƚŚĂƚŵĞĞƚƐh͘^͘WĞŵŝƐƐŝŽŶƐƚĂŶĚĂƌĚƐĨŽƌdŝĞƌϯĞŶŐŝŶĞƐĂŶĚŝŶĐůƵĚĞƉĂƌƚŝĐƵůĂƚĞŵĂƚƚĞƌĞŵŝƐƐŝŽŶƐĐŽŶƚƌŽůĞƋƵŝǀĂůĞŶƚƚŽZ>ĞǀĞůϯǀĞƌŝĨŝĂďůĞĚŝĞƐĞůĞŵŝƐƐŝŽŶĐŽŶƚƌŽůĚĞǀŝĐĞƐƚŚĂƚĂůƚŽŐĞƚŚĞƌĂĐŚŝĞǀĞĂƚůĞĂƐƚĂϱϬƉĞƌĐĞŶƚƌĞĚƵĐƚŝŽŶŝŶƉĂƌƚŝĐƵůĂƚĞŵĂƚƚĞƌĞǆŚĂƵƐƚŝŶĐŽŵƉĂƌŝƐŽŶƚŽƵŶĐŽŶƚƌŽůůĞĚĞƋƵŝƉŵĞŶƚ͖ĂůƚĞƌŶĂƚŝǀĞůǇ;ŽƌŝŶĐŽŵďŝŶĂƚŝŽŶͿ͘ď͘ hƐĞŽĨĞůĞĐƚƌŝĐĂůŽƌŶŽŶͲĚŝĞƐĞůĨƵĞůĞĚĞƋƵŝƉŵĞŶƚ͘Ϯ͘ ĞǁĂƚĞƌŝŶŐƉƵŵƉƐƐŚĂůůďĞƉŽǁĞƌĞĚďǇĞůĞĐƚƌŝĐŝƚǇ͘ϯ͘ hƐĞŽĨĞůĞĐƚƌŝĐƉŽƌƚĂďůĞĞƋƵŝƉŵĞŶƚĨŽůůŽǁŝŶŐƚŚĞƐŝƚĞƉƌĞƉĂƌĂƚŝŽŶĂŶĚŐƌĂĚŝŶŐƉŚĂƐĞƐ͘ϰ͘ůƚĞƌŶĂƚŝǀĞůǇ͕ƚŚĞĂƉƉůŝĐĂŶƚŵĂǇĚĞǀĞůŽƉĂŶŽƚŚĞƌĐŽŶƐƚƌƵĐƚŝŽŶŽƉĞƌĂƚŝŽŶƐƉůĂŶĚĞŵŽŶƐƚƌĂƚŝŶŐƚŚĂƚƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶĞƋƵŝƉŵĞŶƚƵƐĞĚŽŶͲƐŝƚĞǁŽƵůĚĂĐŚŝĞǀĞĂƌĞĚƵĐƚŝŽŶŝŶĐŽŶƐƚƌƵĐƚŝŽŶĚŝĞƐĞůƉĂƌƚŝĐƵůĂƚĞŵĂƚƚĞƌĞŵŝƐƐŝŽŶƐďǇϱϬƉĞƌĐĞŶƚŽƌŐƌĞĂƚĞƌ͘ůĞŵĞŶƚƐŽĨƚŚĞƉůĂŶĐŽƵůĚŝŶĐůƵĚĞĂĐŽŵďŝŶĂƚŝŽŶŽĨƐŽŵĞŽĨƚŚĞĨŽůůŽǁŝŶŐŵĞĂƐƵƌĞƐ͗ͻ /ŵƉůĞŵĞŶƚĂƚŝŽŶŽĨEŽ͘ϭĂďŽǀĞƚŽƵƐĞdŝĞƌϰŽƌĂůƚĞƌŶĂƚŝǀĞůǇĨƵĞůĞĚĞƋƵŝƉŵĞŶƚ͕ͻ /ŶƐƚĂůůĂƚŝŽŶŽĨĞůĞĐƚƌŝĐƉŽǁĞƌůŝŶĞƐĚƵƌŝŶŐĞĂƌůǇĐŽŶƐƚƌƵĐƚŝŽŶƉŚĂƐĞƐƚŽĂǀŽŝĚƵƐĞŽĨĚŝĞƐĞůŐĞŶĞƌĂƚŽƌƐĂŶĚĐŽŵƉƌĞƐƐŽƌƐ͕ͻ hƐĞŽĨĞůĞĐƚƌŝĐĂůůǇͲƉŽǁĞƌĞĚĞƋƵŝƉŵĞŶƚ͕ͻ &ŽƌŬůŝĨƚƐĂŶĚĂĞƌŝĂůůŝĨƚƐƵƐĞĚĨŽƌĞǆƚĞƌŝŽƌĂŶĚŝŶƚĞƌŝŽƌďƵŝůĚŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶƐŚĂůůďĞĞůĞĐƚƌŝĐŽƌƉƌŽƉĂŶĞͬŶĂƚƵƌĂůŐĂƐƉŽǁĞƌĞĚ͕ͻ ŚĂŶŐĞŝŶĐŽŶƐƚƌƵĐƚŝŽŶďƵŝůĚͲŽƵƚƉůĂŶƐƚŽůĞŶŐƚŚĞŶƉŚĂƐĞƐ͕ĂŶĚͻ /ŵƉůĞŵĞŶƚĂƚŝŽŶŽĨĚŝĨĨĞƌĞŶƚďƵŝůĚŝŶŐƚĞĐŚŶŝƋƵĞƐƚŚĂƚƌĞƐƵůƚŝŶůĞƐƐĚŝĞƐĞůĞƋƵŝƉŵĞŶƚƵƐĂŐĞ͘^ƵĐŚĂĐŽŶƐƚƌƵĐƚŝŽŶŽƉĞƌĂƚŝŽŶƐƉůĂŶǁŽƵůĚďĞƐƵďũĞĐƚƚŽƌĞǀŝĞǁďǇĂŶĂŝƌƋƵĂůŝƚǇĞǆƉĞƌƚĂŶĚĂƉƉƌŽǀĞĚďǇƚŚĞŝƚǇƉƌŝŽƌƚŽĐŽŶƐƚƌƵĐƚŝŽŶ͘ ϴϬϬhhYhsEhWZK:dͲDDZWW'ϯK&ϭϬDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚŝŽůŽŐŝĐĂůZĞƐŽƵƌĐĞƐDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞŝŽͲϭ͗WƌĞͲŽŶƐƚƌƵĐƚŝŽŶEĞƐƚŝŶŐŝƌĚ^ƵƌǀĞǇ͘/ŶŝƚŝĂƚŝŽŶŽĨĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚŝĞƐĚƵƌŝŶŐƚŚĞĂǀŝĂŶŶĞƐƚŝŶŐƐĞĂƐŽŶ;&ĞďƌƵĂƌǇϭϱƚŚƌŽƵŐŚ^ĞƉƚĞŵďĞƌϭϱͿƐŚĂůůďĞĂǀŽŝĚĞĚƚŽƚŚĞĞǆƚĞŶƚĨĞĂƐŝďůĞ͘/ĨĐŽŶƐƚƌƵĐƚŝŽŶŝŶŝƚŝĂƚŝŽŶĚƵƌŝŶŐƚŚĞŶĞƐƚŝŶŐƐĞĂƐŽŶĐĂŶŶŽƚďĞĂǀŽŝĚĞĚ͕ƉƌĞͲĐŽŶƐƚƌƵĐƚŝŽŶƐƵƌǀĞǇƐĨŽƌŶĞƐƚŝŶŐďŝƌĚƐƉƌŽƚĞĐƚĞĚďǇƚŚĞDŝŐƌĂƚŽƌǇŝƌĚdƌĞĂƚǇĐƚŽĨϭϵϭϴĂŶĚͬŽƌ&ŝƐŚĂŶĚ'ĂŵĞŽĚĞŽĨĂůŝĨŽƌŶŝĂǁŝƚŚŝŶϭϬϬĨĞĞƚŽĨĂĚĞǀĞůŽƉŵĞŶƚƐŝƚĞŝŶƚŚĞƉƌŽũĞĐƚĂƌĞĂƐŚĂůůďĞĐŽŶĚƵĐƚĞĚǁŝƚŚŝŶϭϰĚĂǇƐƉƌŝŽƌƚŽŝŶŝƚŝĂƚŝŽŶŽĨĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚŝĞƐ͘/ĨĂĐƚŝǀĞŶĞƐƚƐĂƌĞĨŽƵŶĚ͕ĂϭϬϬͲĨŽŽƚďƵĨĨĞƌĂƌĞĂƐŚĂůůďĞĞƐƚĂďůŝƐŚĞĚĂƌŽƵŶĚƚŚĞŶĞƐƚŝŶǁŚŝĐŚŶŽĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚǇƚĂŬĞƐƉůĂĐĞ͘dŚĞďƵĨĨĞƌǁŝĚƚŚŵĂǇďĞŵŽĚŝĨŝĞĚƵƉŽŶƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐŽĨĂƋƵĂůŝĨŝĞĚďŝŽůŽŐŝƐƚƌĞŐĂƌĚŝŶŐƚŚĞĂƉƉƌŽƉƌŝĂƚĞďƵĨĨĞƌŝŶĐŽŶƐŝĚĞƌĂƚŝŽŶŽĨƐƉĞĐŝĞƐ͕ƐƚĂŐĞŽĨŶĞƐƚŝŶŐ͕ůŽĐĂƚŝŽŶŽĨƚŚĞŶĞƐƚ͕ĂŶĚƚǇƉĞŽĨĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚǇďĂƐĞĚƵƉŽŶƉƵďůŝƐŚĞĚƉƌŽƚŽĐŽůƐĂŶĚͬŽƌŐƵŝĚĞůŝŶĞƐĨƌŽŵƚŚĞh͘^͘&ŝƐŚĂŶĚtŝůĚůŝĨĞ^ĞƌǀŝĐĞŽƌĂůŝĨŽƌŶŝĂĞƉĂƌƚŵĞŶƚŽĨ&ŝƐŚĂŶĚtŝůĚůŝĨĞ;h^&t^͕&tͿŽƌƚŚƌŽƵŐŚĐŽŶƐƵůƚĂƚŝŽŶǁŝƚŚh^&t^ĂŶĚͬŽƌ&t͘dŚĞďŝŽůŽŐŝƐƚŵĂǇĂůƐŽĚĞƚĞƌŵŝŶĞƚŚĂƚĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚŝĞƐĐĂŶďĞĂůůŽǁĞĚǁŝƚŚŝŶĂďƵĨĨĞƌĂƌĞĂǁŝƚŚŵŽŶŝƚŽƌŝŶŐďǇƚŚĞďŝŽůŽŐŝƐƚƚŽĂŶĚƐƚŽƉƉĂŐĞŽĨǁŽƌŬŝŶƚŚĂƚĂƌĞĂŝĨĂĚǀĞƌƐĞĞĨĨĞĐƚƐƚŽƚŚĞŶĞƐƚƐĂƌĞŽďƐĞƌǀĞĚ͘dŚĞďƵĨĨĞƌƐŚĂůůďĞŵĂŝŶƚĂŝŶĞĚƵŶƚŝůĂĨƚĞƌƚŚĞŶĞƐƚůŝŶŐƐŚĂǀĞĨůĞĚŐĞĚĂŶĚůĞĨƚƚŚĞŶĞƐƚ͘dŚĞƐĞƐƵƌǀĞǇƐǁŽƵůĚƌĞŵĂŝŶǀĂůŝĚĂƐůŽŶŐĂƐĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚǇŝƐĐŽŶƐŝƐƚĞŶƚůǇŽĐĐƵƌƌŝŶŐŝŶĂŐŝǀĞŶĂƌĞĂĂŶĚǁŽƵůĚďĞĐŽŵƉůĞƚĞĚĂŐĂŝŶŝĨƚŚĞƌĞŝƐĂůĂƉƐĞŝŶĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚŝĞƐŽĨŵŽƌĞƚŚĂŶϭϰĐŽŶƐĞĐƵƚŝǀĞĚĂǇƐĚƵƌŝŶŐƚŚĞŶĞƐƚŝŶŐƐĞĂƐŽŶ͘WƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨŐƌĂĚŝŶŐƉĞƌŵŝƚ͕ŝĨĚƵƌŝŶŐŶĞƐƚŝŶŐƉĞƌŝŽĚͲĂŶĚͲWƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨĂŶǇƐƵďƐĞƋƵĞŶƚŐƌĂĚŝŶŐŽƌĐŽŶƐƚƌƵĐƚŝŽŶƉĞƌŵŝƚŝĨĚƵƌŝŶŐŶĞƐƚŝŶŐƉĞƌŝŽĚƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŵƉůĞƚŝŽŶŽĨƐƵƌǀĞǇĂŶĚ͕ŝĨďŝƌĚƐƉƌĞƐĞŶƚ͕ƉƌŽǀŝƐŝŽŶŽĨďƵĨĨĞƌͲĂŶĚͲŽŶĨŝƌŵŶŽŐĂƉŝŶĂĐƚŝǀŝƚǇŽǀĞƌϭϰĚĂǇƐŽƌǀĞƌŝĨǇƵƉĚĂƚĞĚƐƵƌǀĞǇ^^&WůĂŶŶŝŶŐŝǀŝƐŝŽŶ ƵůƚƵƌĂůĂŶĚdƌŝďĂůƵůƚƵƌĂůZĞƐŽƵƌĐĞƐDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞƵůͲϭ͗ƵůƚƵƌĂůZĞƐŽƵƌĐĞƐtŽƌŬĞƌŶǀŝƌŽŶŵĞŶƚĂůǁĂƌĞŶĞƐƐWƌŽŐƌĂŵ;tWͿ͘ƋƵĂůŝĨŝĞĚĂƌĐŚĂĞŽůŽŐŝƐƚƐŚĂůůĐŽŶĚƵĐƚĂtWƚƌĂŝŶŝŶŐĨŽƌĂůůĐŽŶƐƚƌƵĐƚŝŽŶƉĞƌƐŽŶŶĞůŽŶƚŚĞƉƌŽũĞĐƚƐŝƚĞƉƌŝŽƌƚŽĐŽŶƐƚƌƵĐƚŝŽŶĂŶĚŐƌŽƵŶĚͲWƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨĐŽŶƐƚƌƵĐƚŝŽŶƉĞƌŵŝƚƐƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐƉƌŽǀŝĚĞĂĐŬŶŽǁůĞĚŐŵĞŶƚŽĨƌĞƋƵŝƌĞŵĞŶƚƐ^^&ƵŝůĚŝŶŐŝǀŝƐŝŽŶ W'ϰK&ϭϬ ϴϬϬhhYhsEhWZK:dͲDDZW DŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚĚŝƐƚƵƌďŝŶŐĂĐƚŝǀŝƚŝĞƐ͘dŚĞƚƌĂŝŶŝŶŐƐŚĂůůŝŶĐůƵĚĞďĂƐŝĐŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚƚŚĞƚǇƉĞƐŽĨƉĂůĞŽŶƚŽůŽŐŝĐĂů͕ĂƌĐŚĂĞŽůŽŐŝĐĂů͕ĂŶĚͬŽƌƚƌŝďĂůĂƌƚŝĨĂĐƚƐĂŶĚƌĞƐŽƵƌĐĞƐƚŚĂƚŵŝŐŚƚďĞĞŶĐŽƵŶƚĞƌĞĚĚƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚŝĞƐ͕ĂŶĚƉƌŽĐĞĚƵƌĞƐƚŽĨŽůůŽǁŝŶƚŚĞĞǀĞŶƚŽĨĂĚŝƐĐŽǀĞƌǇ͘dŚŝƐƚƌĂŝŶŝŶŐƐŚĂůůďĞƉƌŽǀŝĚĞĚĨŽƌĂŶǇƉĞƌƐŽŶŶĞůǁŝƚŚƚŚĞƉŽƚĞŶƚŝĂůƚŽďĞŝŶǀŽůǀĞĚŝŶĂĐƚŝǀŝƚŝĞƐƚŚĂƚĐŽƵůĚĚŝƐƚƵƌďŶĂƚŝǀĞƐŽŝůƐ͘ͲĂŶĚͲWƌŝŽƌƚŽŝŶŝƚŝĂƚŝŽŶŽĨŐƌĂĚŝŶŐŽƌĞǆĐĂǀĂƚŝŽŶͲĂŶĚͲsĞƌŝĨǇƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞŵĞƚĚƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞƵůͲϮ͗,ĂůƚŽŶƐƚƌƵĐƚŝŽŶĐƚŝǀŝƚǇ͕ǀĂůƵĂƚĞ&ŝŶĚĂŶĚ/ŵƉůĞŵĞŶƚDŝƚŝŐĂƚŝŽŶ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚƉƌĞǀŝŽƵƐůǇƵŶŝĚĞŶƚŝĨŝĞĚƉĂůĞŽŶƚŽůŽŐŝĐĂů͕ĂƌĐŚĂĞŽůŽŐŝĐĂů͕ŽƌƚƌŝďĂůƌĞƐŽƵƌĐĞƐĂƌĞƵŶĐŽǀĞƌĞĚĚƵƌŝŶŐƐŝƚĞƉƌĞƉĂƌĂƚŝŽŶ͕ĞǆĐĂǀĂƚŝŽŶŽƌŽƚŚĞƌĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚǇ͕ƚŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚƐŚĂůůĐĞĂƐĞŽƌĞŶƐƵƌĞƚŚĂƚĂůůƐƵĐŚĂĐƚŝǀŝƚǇǁŝƚŚŝŶϮϱĨĞĞƚŽĨƚŚĞĚŝƐĐŽǀĞƌǇŝƐĐĞĂƐĞĚƵŶƚŝůƚŚĞƌĞƐŽƵƌĐĞƐŚĂǀĞďĞĞŶĞǀĂůƵĂƚĞĚďǇĂƋƵĂůŝĨŝĞĚƉƌŽĨĞƐƐŝŽŶĂů͕ǁŚŽƐŚĂůůďĞƌĞƚĂŝŶĞĚďǇƚŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚ͕ĂŶĚƐƉĞĐŝĨŝĐŵĞĂƐƵƌĞƐĐĂŶďĞŝŵƉůĞŵĞŶƚĞĚďǇƚŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚƚŽƉƌŽƚĞĐƚƚŚĞƐĞƌĞƐŽƵƌĐĞƐŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƐĞĐƚŝŽŶƐϮϭϬϴϯ͘ϮĂŶĚϮϭϬϴϰ͘ϭŽĨƚŚĞĂůŝĨŽƌŶŝĂWƵďůŝĐZĞƐŽƵƌĐĞƐŽĚĞ͘WƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨŐƌĂĚŝŶŐƉĞƌŵŝƚƐͲĂŶĚͲƵƌŝŶŐŐƌĂĚŝŶŐƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐƉƌŽǀŝĚĞĂĐŬŶŽǁůĞĚŐŵĞŶƚŽĨƌĞƋƵŝƌĞŵĞŶƚƐͲĂŶĚͲsĞƌŝĨǇƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞŵĞƚĚƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶ^^&ƵŝůĚŝŶŐŝǀŝƐŝŽŶDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞƵůͲϯ͗,ĂůƚŽŶƐƚƌƵĐƚŝŽŶĐƚŝǀŝƚǇ͕ǀĂůƵĂƚĞZĞŵĂŝŶƐĂŶĚdĂŬĞƉƉƌŽƉƌŝĂƚĞĐƚŝŽŶŝŶŽŽƌĚŝŶĂƚŝŽŶǁŝƚŚEĂƚŝǀĞŵĞƌŝĐĂŶ,ĞƌŝƚĂŐĞŽŵŵŝƐƐŝŽŶ͘/ŶƚŚĞĞǀĞŶƚƚŚĂƚŚƵŵĂŶƌĞŵĂŝŶƐĂƌĞƵŶĐŽǀĞƌĞĚĚƵƌŝŶŐƐŝƚĞƉƌĞƉĂƌĂƚŝŽŶ͕ĞǆĐĂǀĂƚŝŽŶŽƌŽƚŚĞƌĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚǇ͕ƚŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚƐŚĂůůĐĞĂƐĞŽƌĞŶƐƵƌĞƚŚĂƚĂůůƐƵĐŚĂĐƚŝǀŝƚǇǁŝƚŚŝŶϮϱĨĞĞƚŽĨƚŚĞĚŝƐĐŽǀĞƌǇŝƐĐĞĂƐĞĚƵŶƚŝůƚŚĞƌĞŵĂŝŶƐŚĂǀĞďĞĞŶĞǀĂůƵĂƚĞĚďǇƚŚĞŽƵŶƚǇŽƌŽŶĞƌ͕ǁŚŝĐŚĞǀĂůƵĂƚŝŽŶƐŚĂůůďĞĂƌƌĂŶŐĞĚďǇƚŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚ͕ĂŶĚĂƉƉƌŽƉƌŝĂƚĞĂĐƚŝŽŶƚĂŬĞŶďǇƚŚĞƉƌŽũĞĐƚĂƉƉůŝĐĂŶƚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƐĞĐƚŝŽŶϳϬϱϬ͘ϱŽĨƚŚĞĂůŝĨŽƌŶŝĂ,ĞĂůƚŚĂŶĚ^ĂĨĞƚǇŽĚĞŽƌ͕ŝĨƚŚĞƌĞŵĂŝŶƐĂƌĞEĂƚŝǀĞŵĞƌŝĐĂŶ͕ŝŶĐŽŽƌĚŝŶĂƚŝŽŶǁŝƚŚƚŚĞEĂƚŝǀĞŵĞƌŝĐĂŶ,ĞƌŝƚĂŐĞŽŵŵŝƐƐŝŽŶĂŶĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƐĞĐƚŝŽŶϱϬϵϳ͘ϵϴŽĨƚŚĞĂůŝĨŽƌŶŝĂWƵďůŝĐZĞƐŽƵƌĐĞƐŽĚĞ͘WƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨŐƌĂĚŝŶŐƉĞƌŵŝƚƐͲĂŶĚͲƵƌŝŶŐŐƌĂĚŝŶŐƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐƉƌŽǀŝĚĞĂĐŬŶŽǁůĞĚŐŵĞŶƚŽĨƌĞƋƵŝƌĞŵĞŶƚƐͲĂŶĚͲsĞƌŝĨǇƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞŵĞƚĚƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶ^^&ƵŝůĚŝŶŐŝǀŝƐŝŽŶ ϴϬϬhhYhsEhWZK:dͲDDZWW'ϱK&ϭϬDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚ'ĞŽůŽŐǇĂŶĚ^ŽŝůƐDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞ'ĞŽͲϭ͗ŽŵƉůŝĂŶĐĞǁŝƚŚĂĚĞƐŝŐŶͲůĞǀĞů'ĞŽƚĞĐŚŶŝĐĂů/ŶǀĞƐƚŝŐĂƚŝŽŶƌĞƉŽƌƚƉƌĞƉĂƌĞĚďǇĂZĞŐŝƐƚĞƌĞĚ'ĞŽƚĞĐŚŶŝĐĂůŶŐŝŶĞĞƌĂŶĚǁŝƚŚ^ƚƌƵĐƚƵƌĂůĞƐŝŐŶWůĂŶƐĂƐƉƌĞƉĂƌĞĚďǇĂ>ŝĐĞŶƐĞĚWƌŽĨĞƐƐŝŽŶĂůŶŐŝŶĞĞƌ͘WƌŽƉĞƌĨŽƵŶĚĂƚŝŽŶĞŶŐŝŶĞĞƌŝŶŐĂŶĚĐŽŶƐƚƌƵĐƚŝŽŶƐŚĂůůďĞƉĞƌĨŽƌŵĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐŽĨĂZĞŐŝƐƚĞƌĞĚ'ĞŽƚĞĐŚŶŝĐĂůŶŐŝŶĞĞƌĂŶĚĂ>ŝĐĞŶƐĞĚWƌŽĨĞƐƐŝŽŶĂůŶŐŝŶĞĞƌ͘dŚĞƐƚƌƵĐƚƵƌĂůĞŶŐŝŶĞĞƌŝŶŐĚĞƐŝŐŶ͕ǁŝƚŚƐƵƉƉŽƌƚŝŶŐ'ĞŽƚĞĐŚŶŝĐĂů/ŶǀĞƐƚŝŐĂƚŝŽŶ͕ƐŚĂůůŝŶĐŽƌƉŽƌĂƚĞƐĞŝƐŵŝĐƉĂƌĂŵĞƚĞƌƐĐŽŵƉůŝĂŶƚǁŝƚŚƚŚĞĂůŝĨŽƌŶŝĂƵŝůĚŝŶŐŽĚĞ͘WƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨďƵŝůĚŝŶŐƉĞƌŵŝƚƐƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐƉƌŽǀŝĚĞĂĐŬŶŽǁůĞĚŐĞŵĞŶƚŽĨŐĞŽƚĞĐŚŶŝĐĂůƌĞĐŽŵŵĞŶĚĂƚŝŽŶƐ^^&ƵŝůĚŝŶŐŝǀŝƐŝŽŶ ,ĂǌĂƌĚƐĂŶĚ,ĂǌĂƌĚŽƵƐDĂƚĞƌŝĂůƐDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞ,ĂǌͲϭ͗/ŵƉůĞŵĞŶƚ^ŽŝůDĂŶĂŐĞŵĞŶƚĂŶĚ,ĞĂůƚŚĂŶĚ^ĂĨĞƚǇWůĂŶƐ͘dŚĞĂƉƉůŝĐĂŶƚ͛ƐĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐŚĂůůŝŵƉůĞŵĞŶƚƐŽŝůŵĂŶĂŐĞŵĞŶƚĂŶĚŚĞĂůƚŚĂŶĚƐĂĨĞƚǇƉůĂŶƐƚŽĨĂĐŝůŝƚĂƚĞĐŽŵƉůŝĂŶĐĞǁŝƚŚĂƉƉůŝĐĂďůĞĨĞĚĞƌĂů͕ƐƚĂƚĞ͕ĂŶĚůŽĐĂůůĂǁƐĂŶĚƌĞŐƵůĂƚŝŽŶƐ͕ĂƉƉůŝĐĂďůĞƚŽĞĂƌƚŚǁŽƌŬĂĐƚŝǀŝƚŝĞƐĂƚƚŚĞƐŝƚĞĂƐĂƌĞƐƵůƚŽĨƚŚĞƌĞƉŽƌƚĞĚƉĞƚƌŽůĞƵŵŚǇĚƌŽĐĂƌďŽŶƐĂŶĚǀŽůĂƚŝůĞŽƌŐĂŶŝĐĐŽŵƉŽƵŶĚĐŽŶĐĞŶƚƌĂƚŝŽŶƐŝŶƚŚĞƐŽŝů͘dŚĞƐĞƉůĂŶƐŵƵƐƚďĞĨŝůĞĚǁŝƚŚƚŚĞŝƚǇďĞĨŽƌĞĐŽŶƐƚƌƵĐƚŝŽŶƉĞƌŵŝƚƐĂƌĞŐƌĂŶƚĞĚĂŶĚĂƌĞĂŶƚŝĐŝƉĂƚĞĚƚŽŝŶĐůƵĚĞƚŚĞĨŽůůŽǁŝŶŐĐŽŵƉŽŶĞŶƚƐ͗ϭ͘ ^ŽŝůDĂŶĂŐĞŵĞŶƚWůĂŶ͘ZĞĐĞŶƚĂŶĂůǇƚŝĐĂůƌĞƐƵůƚƐŝŶĚŝĐĂƚĞƚŚĂƚƐŽŵĞƐŝƚĞƐŽŝůƐĐŽŶƚĂŝŶƐůŝŐŚƚůǇĞůĞǀĂƚĞĚĐŽŶĐĞŶƚƌĂƚŝŽŶƐŽĨ^sKƐ͕sKƐ͕dW,͕ĂŶĚĐĞƌƚĂŝŶŵĞƚĂůƐ͘dŚĞƐŽŝůŵĂŶĂŐĞŵĞŶƚŽďũĞĐƚŝǀĞƐĨŽƌƚŚĞƐŝƚĞĂƌĞƚŽŵŝŶŝŵŝǌĞĞǆƉŽƐƵƌĞŽĨƉŽƚĞŶƚŝĂůůǇŚĂǌĂƌĚŽƵƐĐŽŶƐƚŝƚƵĞŶƚƐŝŶƐŽŝůƚŽĐŽŶƐƚƌƵĐƚŝŽŶǁŽƌŬĞƌƐ͕ŶĞĂƌďǇƌĞƐŝĚĞŶƚƐĂŶĚƉĞĚĞƐƚƌŝĂŶƐ͕ĂŶĚĨƵƚƵƌĞƵƐĞƌƐŽĨƚŚĞƐŝƚĞ͘ƐŝƚĞͲƐƉĞĐŝĨŝĐƐŽŝůŵĂŶĂŐĞŵĞŶƚƉůĂŶǁŝůůďĞĚĞǀĞůŽƉĞĚďĂƐĞĚŽŶƌĞĐĞŶƚĐŽŵƉƌĞŚĞŶƐŝǀĞƐƵďƐƵƌĨĂĐĞŝŶǀĞƐƚŝŐĂƚŝŽŶƐĐŽǀĞƌŝŶŐƚŚĞƐŝƚĞƐŽŝůƐƚŽĚĞƉƚŚƐĞǆĐĞĞĚŝŶŐƉůĂŶŶĞĚĞǆĐĂǀĂƚŝŽŶƐĂŶĚƚŚĞƵŶĚĞƌůǇŝŶŐŐƌŽƵŶĚǁĂƚĞƌ͘dŚĞƐŽŝůŵĂŶĂŐĞŵĞŶƚƉůĂŶŝƐŝŶƚĞŶĚĞĚƚŽĨĂĐŝůŝƚĂƚĞĐŽŵƉůŝĂŶĐĞǁŝƚŚƌĞůĞǀĂŶƚĨĞĚĞƌĂů͕ƐƚĂƚĞ͕ĂŶĚůŽĐĂůWƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨŐƌĂĚŝŶŐƉĞƌŵŝƚƐͲĂŶĚͲƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶƉƉůŝĐĂŶƚsĞƌŝĨǇĐŽŶƐƚƌƵĐƚŝŽŶĐŽŶƚƌĂĐƚŽƌƐƉƌŽǀŝĚĞĂĐŬŶŽǁůĞĚŐĞŵĞŶƚŽĨƌĞƋƵŝƌĞŵĞŶƚƐͲĂŶĚͲsĞƌŝĨǇƌĞƋƵŝƌĞŵĞŶƚƐĂƌĞŵĞƚĚƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶ^^&ƵŝůĚŝŶŐŝǀŝƐŝŽŶ W'ϲK&ϭϬ ϴϬϬhhYhsEhWZK:dͲDDZW DŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚůĂǁƐĂŶĚƌĞŐƵůĂƚŝŽŶƐ͕ĂƉƉůŝĐĂďůĞƚŽĞĂƌƚŚǁŽƌŬĂĐƚŝǀŝƚŝĞƐĂƚƚŚĞƐŝƚĞĂƐĂƌĞƐƵůƚŽĨƚŚĞŝĚĞŶƚŝĨŝĞĚĐŽŶƚĂŵŝŶĂƚŝŽŶƉƌŽĨŝůĞƐ͘^ŽŵĞŽĨƚŚĞĞǆĐĂǀĂƚĞĚŵĂƚĞƌŝĂůŝŶƚŚĞƵƉƉĞƌϱĨĞĞƚŵĂǇŶĞĞĚƚŽďĞĚŝƐƉŽƐĞĚŽĨĨͲƐŝƚĞĂƚĂůĂƐƐ//ŶŽŶͲŚĂǌĂƌĚŽƵƐƌĞŐƵůĂƚĞĚůĂŶĚĨŝůůĂŶĚͬŽƌĂƐƵŶƌĞƐƚƌŝĐƚŝǀĞǁĂƐƚĞďĂƐĞĚŽŶĚŝƐƉŽƐĂůĨĂĐŝůŝƚǇ͛ƐĂĐĐĞƉƚĂŶĐĞĐƌŝƚĞƌŝĂ͘dŚĞĐŽŶƚƌĂĐƚŽƌǁŝůůĞƐƚĂďůŝƐŚĂƉƉƌŽƉƌŝĂƚĞŽĨĨͲƐŝƚĞĚŝƐƉŽƐĂůůŽĐĂƚŝŽŶƐĂŶĚĚŝƌĞĐƚƚƌƵĐŬůŽĂĚŝŶŐƐĐŚĞĚƵůŝŶŐĂŶĚƚƌĂĐŬŝŶŐĂŶĚƌĞĐŽƌĚŝŶŐŽĨĂůůƐŚŝƉŵĞŶƚƐƉĞƌĂƉƉůŝĐĂďůĞƌĞŐƵůĂƚŝŽŶƐĂŶĚͬŽƌƐƚŽĐŬƉŝůĞůŽĐĂƚŝŽŶƐŽŶƚŚĞƐŝƚĞƚŽƉƌŽƉĞƌůǇƐĞŐƌĞŐĂƚĞ͕ĐŽǀĞƌ͕ŵŽŝƐƚƵƌĞĐŽŶƚƌŽů͕ĂŶĚƉƌŽĨŝůĞƚŚĞĞǆĐĂǀĂƚĞĚŵĂƚĞƌŝĂů͘&ƵƌƚŚĞƌƚĞƐƚŝŶŐŵĂǇŝŶƐƚĞĂĚĚĞƚĞƌŵŝŶĞƚŚĂƚŶŽƐƉĞĐŝĂůƐŽŝůŚĂŶĚůŝŶŐŝƐƌĞƋƵŝƌĞĚ͘hŶůĞƐƐĨƌŽŵĂĚŽĐƵŵĞŶƚĞĚĐůĞĂŶƐŽƵƌĐĞƐƵĐŚĂƐĂƋƵĂƌƌǇ͕ƐŽŝůŝŵƉŽƌƚĞĚŽŶƚŽƚŚĞƐŝƚĞǁŝůůďĞƚĞƐƚĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚĞ͞ůĞĂŶ/ŵƉŽƌƚĞĚ&ŝůůDĂƚĞƌŝĂů͟ŝŶĨŽƌŵĂƚŝŽŶĂĚǀŝƐŽƌǇĚĞǀĞůŽƉĞĚďǇƚŚĞĂůŝĨŽƌŶŝĂd^ŝŶKĐƚŽďĞƌϮϬϬϭ͘Ϯ͘ ,ĞĂůƚŚĂŶĚ^ĂĨĞƚǇWůĂŶ͘dŚĞƉŽƚĞŶƚŝĂůŚĞĂůƚŚƌŝƐŬƚŽŽŶͲƐŝƚĞĐŽŶƐƚƌƵĐƚŝŽŶǁŽƌŬĞƌƐĂŶĚƚŚĞƉƵďůŝĐǁŝůůďĞŵŝŶŝŵŝǌĞĚďǇĚĞǀĞůŽƉŝŶŐĂŶĚŝŵƉůĞŵĞŶƚŝŶŐĂĐŽŵƉƌĞŚĞŶƐŝǀĞ,ĞĂůƚŚĂŶĚ^ĂĨĞƚǇWůĂŶ;,^WͿ͘dŚĞĐŽŶƚƌĂĐƚŽƌǁŝůůďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĚĞǀĞůŽƉŝŶŐĂŶĚŝŵƉůĞŵĞŶƚŝŶŐƚŚĞ,^W͘dŚĞ,^WƉůĂŶǁŝůůĚĞƐĐƌŝďĞƚŚĞŚĞĂůƚŚĂŶĚƐĂĨĞƚǇƚƌĂŝŶŝŶŐƌĞƋƵŝƌĞŵĞŶƚƐ͕ƐƉĞĐŝĨŝĐƉĞƌƐŽŶĂůŚǇŐŝĞŶĞ͕ĂŶĚŵŽŶŝƚŽƌŝŶŐĞƋƵŝƉŵĞŶƚƚŚĂƚǁŝůůďĞƵƐĞĚĚƵƌŝŶŐĐŽŶƐƚƌƵĐƚŝŽŶƚŽƉƌŽƚĞĐƚĂŶĚǀĞƌŝĨǇƚŚĞŚĞĂůƚŚĂŶĚƐĂĨĞƚǇŽĨƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶǁŽƌŬĞƌƐĂŶĚƚŚĞŐĞŶĞƌĂůƉƵďůŝĐĨƌŽŵĞǆƉŽƐƵƌĞƚŽĐŽŶƐƚŝƚƵĞŶƚƐŝŶƚŚĞƐŽŝů͕ǁŚŝĐŚŝƐĂŶƚŝĐŝƉĂƚĞĚƚŽŝŶĐůƵĚĞƚŚĞĨŽůůŽǁŝŶŐ͗x ƚŚĞƐŝƚĞǁŝůůďĞĨĞŶĐĞĚ͖x ĞǆƉŽƐĞĚƐŽŝůĂƚƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶƐŝƚĞǁŝůůďĞǁĂƚĞƌĞĚĂƚůĞĂƐƚƚǁŝĐĞĚĂŝůǇƚŽƉƌĞǀĞŶƚǀŝƐŝďůĞĚƵƐƚĨƌŽŵŵŝŐƌĂƚŝŶŐŽĨĨͲƐŝƚĞ͖x ƐƚŽĐŬƉŝůĞƐǁŝůůďĞĐŽǀĞƌĞĚ͖x ǁĂƚĞƌǁŝůůďĞŵŝƐƚĞĚŽƌƐƉƌĂǇĞĚĚƵƌŝŶŐůŽĂĚŝŶŐŽĨŵĂƚĞƌŝĂůŽŶƚŽƚƌƵĐŬƐĨŽƌŽĨĨŚĂƵů͖x ƚƌƵĐŬƐƚƌĂŶƐƉŽƌƚŝŶŐĐŽŶƚĂŵŝŶĂƚĞĚŵĂƚĞƌŝĂůǁŝůůďĞĐŽǀĞƌĞĚǁŝƚŚĂƚĂƌƉĂƵůŝŶŽƌŽƚŚĞƌĐŽǀĞƌ͖ ϴϬϬhhYhsEhWZK:dͲDDZWW'ϳK&ϭϬDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚx ƚŚĞǁŚĞĞůƐŽĨƚŚĞƚƌƵĐŬƐĞǆŝƚŝŶŐƚŚĞƐŝƚĞǁŝůůďĞĐůĞĂŶĞĚƉƌŝŽƌƚŽĞŶƚĞƌŝŶŐƉƵďůŝĐƐƚƌĞĞƚƐ͖x ƉƵďůŝĐƐƚƌĞĞƚƐǁŝůůďĞƐǁĞƉƚĚĂŝůǇŝĨŵĂƚĞƌŝĂůŝƐǀŝƐŝďůĞ͕ĞǆĐĂǀĂƚŝŽŶĂŶĚůŽĂĚŝŶŐĂĐƚŝǀŝƚŝĞƐǁŝůůďĞƐƵƐƉĞŶĚĞĚŝĨǁŝŶĚƐĞǆĐĞĞĚϭϱŵŝůĞƐƉĞƌŚŽƵƌ͖ĂŶĚƚŚĞĨĞŶĐĞǁŝůůďĞƉŽƐƚĞĚǁŝƚŚƌĞƋƵŝƌĞŵĞŶƚƐŽĨƚŚĞƐĂĨĞĚƌŝŶŬŝŶŐǁĂƚĞƌĂŶĚƚŽǆŝĐĞŶĨŽƌĐĞŵĞŶƚĂĐƚ;WƌŽƉŽƐŝƚŝŽŶϲϱͿ͘ϯ͘ ,ĞĂůƚŚĂŶĚ^ĂĨĞƚǇKĨĨŝĐĞƌ͘ƐŝƚĞŚĞĂůƚŚĂŶĚƐĂĨĞƚǇŽĨĨŝĐĞƌŝĚĞŶƚŝĨŝĞĚŝŶƚŚĞ,ĞĂůƚŚĂŶĚ^ĂĨĞƚǇWůĂŶǁŝůůďĞŽŶƐŝƚĞĂƚĂůůƚŝŵĞƐĚƵƌŝŶŐĞǆĐĂǀĂƚŝŽŶĂĐƚŝǀŝƚŝĞƐƚŽĞŶƐƵƌĞƚŚĂƚĂůůŚĞĂůƚŚĂŶĚƐĂĨĞƚǇŵĞĂƐƵƌĞƐĂƌĞŵĂŝŶƚĂŝŶĞĚ͘dŚĞŚĞĂůƚŚĂŶĚƐĂĨĞƚǇŽĨĨŝĐĞƌǁŝůůŚĂǀĞĂƵƚŚŽƌŝƚǇƚŽĚŝƌĞĐƚĂŶĚƐƚŽƉ;ŝĨŶĞĐĞƐƐĂƌǇͿĂůůĐŽŶƐƚƌƵĐƚŝŽŶĂĐƚŝǀŝƚŝĞƐŝŶŽƌĚĞƌƚŽĞŶƐƵƌĞĐŽŵƉůŝĂŶĐĞǁŝƚŚƚŚĞŚĞĂůƚŚĂŶĚƐĂĨĞƚǇƉůĂŶ͘ϰ͘ ƵƐƚŽŶƚƌŽů͘ƵƌŝŶŐĂůůĞǆĐĂǀĂƚŝŽŶĂĐƚŝǀŝƚŝĞƐ͕ĚƵƐƚĐŽŶƚƌŽůŵĞĂƐƵƌĞƐǁŝůůďĞŝŵƉůĞŵĞŶƚĞĚƚŽƌĞĚƵĐĞƉŽƚĞŶƚŝĂůĞǆƉŽƐƵƌĞ͘dŚĞƐĞŵĞĂƐƵƌĞƐŵĂǇŝŶĐůƵĚĞŵŽŝƐƚƵƌĞĐŽŶĚŝƚŝŽŶŝŶŐƚŚĞƐŽŝůĂŶĚĐŽǀĞƌŝŶŐĞǆƉŽƐĞĚƐŽŝůĂŶĚƐƚŽĐŬƉŝůĞƐǁŝƚŚǁĞŝŐŚƚĞĚĚŽǁŶƉůĂƐƚŝĐƐŚĞĞƚŝŶŐƚŽƉƌĞǀĞŶƚĞǆƉŽƐƵƌĞŽĨƚŚĞƐŽŝů͘ƵƐƚĐŽŶƚƌŽůŵĞĂƐƵƌĞƐĂƚĂŵŝŶŝŵƵŵǁŝůůŝŶĐůƵĚĞ͗x ŽǀĞƌŝŶŐƐŽŝůƐƚŽĐŬƉŝůĞƐǁŝƚŚƉůĂƐƚŝĐƐŚĞĞƚŝŶŐ͘x tĂƚĞƌŝŶŐƵŶĐŽǀĞƌĞĚŐƌŽƵŶĚƐƵƌĨĂĐĞĂƚƚŚĞƐŝƚĞ͖ƵƐĞŽĨǁĂƚĞƌǁŝůůďĞůŝŵŝƚĞĚƚŽƉƌĞǀĞŶƚƌƵŶŽĨĨ͘x DŝƐƚŝŶŐŽƌƐƉƌĂǇŝŶŐŽĨƐŽŝůĚƵƌŝŶŐĞǆĐĂǀĂƚŝŽŶĂŶĚůŽĂĚŝŶŐ͘x ŵƉůĂĐĞŵĞŶƚŽĨŐƌĂǀĞůĂŶĚͬŽƌƌƵďďůĞƉůĂƚĞƐŽŶƐŝƚĞĂĐĐĞƐƐƌŽĂĚƐĂƐĨĞĂƐŝďůĞ͘x dƌƵĐŬƐŚĂƵůŝŶŐƐŽŝůĨƌŽŵƚŚĞƐŝƚĞǁŝůůďĞĐŽǀĞƌĞĚ͘x sŝƐŝďůĞĚƵƐƚǁŝůůďĞŵŽŶŝƚŽƌĞĚĚƵƌŝŶŐĞǆĐĂǀĂƚŝŽŶĂŶĚƐƵďƐƵƌĨĂĐĞĚĞŵŽůŝƚŝŽŶ͘x dŚĞƐŽŝůĚƌŽƉŚĞŝŐŚƚĨƌŽŵĂŶĞǆĐĂǀĂƚŽƌ͛ƐďƵĐŬĞƚŽŶƚŽƐŽŝůƉŝůĞƐŽƌŝŶƚŽƚƌĂŶƐƉŽƌƚƚƌƵĐŬƐǁŝůůďĞŵŝŶŝŵŝǌĞĚ͘x tŝŶĚďƌĞĂŬƐǁŝůůďĞĚĞƉůŽǇĞĚĂƐŶĞĐĞƐƐĂƌǇ͘x /ĨŶĞĐĞƐƐĂƌǇ͕ƚŚĞĂƌĞĂŽĨĞǆĐĂǀĂƚŝŽŶŵĂǇďĞůŝŵŝƚĞĚƚŽƌĞĚƵĐĞĚƵƐƚŐĞŶĞƌĂƚŝŽŶ͘x ^ŝƚĞǀĞŚŝĐůĞƐƉĞĞĚůŝŵŝƚƐ͘ W'ϴK&ϭϬ ϴϬϬhhYhsEhWZK:dͲDDZW DŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚx ^ƚƌĞĞƚƐǁĞĞƉŝŶŐ͘x dĞƌŵŝŶĂƚŝŽŶŽĨĞǆĐĂǀĂƚŝŽŶŝĨǁŝŶĚƐĞǆĐĞĞĚϮϱŵƉŚ͘x ĚĚŝƚŝŽŶŽĨƐŽŝůƐƚĂďŝůŝǌĞƌƐĂŶĚŽƚŚĞƌƌĞƐƉŽŶƐĞƐĂƐŶĞĞĚĞĚ͘ϱ͘ KĚŽƌŽŶƚƌŽů͘/ĨƐƚƌŽŶŐŽĚŽƌƐĂƌĞŶŽƚĞĚĚƵƌŝŶŐĞǆĐĂǀĂƚŝŽŶĂĐƚŝǀŝƚŝĞƐ͕ŽĚŽƌƐƵƉƉƌĞƐƐŝŽŶŵĞĂƐƵƌĞƐǁŝůůďĞŝŵƉůĞŵĞŶƚĞĚďǇƚŚĞ'ĞŶĞƌĂůŽŶƚƌĂĐƚŽƌƚŽŵŝŶŝŵŝǌĞŽĚŽƌĚƵƌŝŶŐĞǆĐĂǀĂƚŝŽŶĂĐƚŝǀŝƚŝĞƐ͘ϲ͘ ^ƚŽƌŵtĂƚĞƌWŽůůƵƚŝŽŶŽŶƚƌŽůƐ͘^ƚŽƌŵǁĂƚĞƌƉŽůůƵƚŝŽŶĐŽŶƚƌŽůƐǁŝůůďĞŝŵƉůĞŵĞŶƚĞĚƚŽŵŝŶŝŵŝǌĞƐƚŽƌŵǁĂƚĞƌƌƵŶŽĨĨĂŶĚƐĞĚŝŵĞŶƚƚƌĂŶƐƉŽƌƚĨƌŽŵƚŚĞƐŝƚĞ͘^ƚŽƌŵtĂƚĞƌWŽůůƵƚŝŽŶWƌĞǀĞŶƚŝŽŶWůĂŶ;^tWWWͿǁŝůůŝĚĞŶƚŝĨǇĞƐƚDĂŶĂŐĞŵĞŶƚWƌĂĐƚŝĐĞƐĨŽƌĂĐƚŝǀŝƚŝĞƐĂƐƐƉĞĐŝĨŝĞĚďǇƚŚĞĂůŝĨŽƌŶŝĂ^ƚŽƌŵtĂƚĞƌĞƐƚDĂŶĂŐĞŵĞŶƚWƌĂĐƚŝĐĞƐ,ĂŶĚďŽŽŬ;^ƚŽƌŵǁĂƚĞƌYƵĂůŝƚǇdĂƐŬ&ŽƌĐĞ͕ϭϵϵϯͿĂŶĚͬŽƌƚŚĞDĂŶƵĂůŽĨ^ƚĂŶĚĂƌĚƐĨŽƌƌŽƐŝŽŶĂŶĚ^ĞĚŝŵĞŶƚŽŶƚƌŽůDĞĂƐƵƌĞƐ;'͕ϭϵϵϱͿ͘dŚĞ^tWWWǁŝůůŝŶĐůƵĚĞƉƌŽƚŽĐŽůƐ;ŝ͘Ğ͕͘ĞĂƌƚŚĚŝŬĞƐĂŶĚĚƌĂŝŶĂŐĞƐǁĂůĞƐͿƚŽĐŽŶƚƌŽůƐƚŽƌŵǁĂƚĞƌĐŽŶƚĂĐƚǁŝƚŚ͕ŽƌƌƵŶŽĨĨĨƌŽŵ͕ƉŽƚĞŶƚŝĂůůǇŝŵƉĂĐƚĞĚƐŽŝůĚƵƌŝŶŐǁĞƚǁĞĂƚŚĞƌĐŽŶĚŝƚŝŽŶƐ͘ϳ͘ 'ƌŽƵŶĚǁĂƚĞƌDĂŶĂŐĞŵĞŶƚ͘'ƌŽƵŶĚǁĂƚĞƌĂƚƚŚĞƐŝƚĞŚĂƐďĞĞŶĞŶĐŽƵŶƚĞƌĞĚĂƚĚĞƉƚŚƐŽĨŶŝŶĞĨĞĞƚƚŽĨŝĨƚĞĞŶĨĞĞƚďĞůŽǁŐƌŽƵŶĚƐƵƌĨĂĐĞ͘ŽŶƐƚƌƵĐƚŝŽŶĚĞǁĂƚĞƌŝŶŐŝƐĂŶƚŝĐŝƉĂƚĞĚďĂƐĞĚŽŶĚĞǀĞůŽƉŵĞŶƚƉůĂŶƐ͘ŶǇĐŽŶƐƚƌƵĐƚŝŽŶĚĞǁĂƚĞƌŝŶŐŵƵƐƚĂĚŚĞƌĞƚŽĂĚŝƐĐŚĂƌŐĞƉĞƌŵŝƚŽďƚĂŝŶĞĚĨƌŽŵƚŚĞ^ŽƵƚŚ^ĂŶ&ƌĂŶĐŝƐĐŽĞƉĂƌƚŵĞŶƚŽĨWƵďůŝĐtŽƌŬƐtĂƚĞƌYƵĂůŝƚǇŽŶƚƌŽůŝǀŝƐŝŽŶ͕ŶǀŝƌŽŶŵĞŶƚĂůŽŵƉůŝĂŶĐĞWƌŽŐƌĂŵŽƌƚŚĞZĞŐŝŽŶĂůtĂƚĞƌYƵĂůŝƚǇŽŶƚƌŽůŽĂƌĚ͘ĂƐĞĚŽŶƚŚĞĂŶĂůǇƚŝĐĂůƌĞƐƵůƚƐ͕ƚŚĞŐƌŽƵŶĚǁĂƚĞƌŵĂǇŶĞĞĚƚŽďĞƚƌĞĂƚĞĚƉƌŝŽƌƚŽĚŝƐĐŚĂƌŐĞ͘ŶǇƉƌŽƉŽƐĞĚŐƌŽƵŶĚǁĂƚĞƌƚƌĞĂƚŵĞŶƚƉƌŝŽƌƚŽĚŝƐĐŚĂƌŐĞǁŝůůƌĞƋƵŝƌĞĂŶĂůǇƚŝĐĂůƚĞƐƚŝŶŐĂŶĚĂƉƉƌŽǀĂůĨƌŽŵƚŚĞĂƉƉƌŽƉƌŝĂƚĞƌĞŐƵůĂƚŽƌǇĂŐĞŶĐǇƉƌŝŽƌƚŽĚŝƐĐŚĂƌŐŝŶŐ͘ϴ͘ ŽŶƚŝŶŐĞŶĐǇWůĂŶƐĨŽƌhŶŬŶŽǁŶͬhŶĞǆƉĞĐƚĞĚŽŶĚŝƚŝŽŶƐ͘dŚĞĨŽůůŽǁŝŶŐƚĂƐŬƐƐŚĂůůďĞŝŵƉůĞŵĞŶƚĞĚĚƵƌŝŶŐĞǆĐĂǀĂƚŝŽŶĂĐƚŝǀŝƚŝĞƐŝĨƵŶŬŶŽǁŶŚŝƐƚŽƌŝĐĂůƐƵďƐƵƌĨĂĐĞĨĞĂƚƵƌĞƐĂŶĚͬŽƌƵŶĂŶƚŝĐŝƉĂƚĞĚŚĂǌĂƌĚŽƵƐŵĂƚĞƌŝĂůƐĂƌĞĞŶĐŽƵŶƚĞƌĞĚ͘^ƵĐŚŵĂƚĞƌŝĂůƐŵĂǇŝŶĐůƵĚĞƵŶĂĐĐŽƵŶƚĞĚĨŽƌƵŶĚĞƌŐƌŽƵŶĚƐƚŽƌĂŐĞ ϴϬϬhhYhsEhWZK:dͲDDZWW'ϵK&ϭϬDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚƚĂŶŬƐ;h^dͿĂŶĚĂƐƐŽĐŝĂƚĞĚƉƌŽĚƵĐƚůŝŶĞƐ͕ƐƵŵƉƐ͕ĂŶĚͬŽƌǀĂƵůƚƐ͕ĨŽƌŵĞƌŵŽŶŝƚŽƌŝŶŐǁĞůůƐ͕ĂŶĚͬŽƌƐŽŝůǁŝƚŚƐŝŐŶŝĨŝĐĂŶƚƉĞƚƌŽůĞƵŵŚǇĚƌŽĐĂƌďŽŶŽĚŽƌƐĂŶĚͬŽƌƐƚĂŝŶƐ͘x ^ƚŽƉǁŽƌŬŝŶƚŚĞĂƌĞĂǁŚĞƌĞƚŚĞƐƵƐƉĞĐƚŵĂƚĞƌŝĂůŝƐĞŶĐŽƵŶƚĞƌĞĚĂŶĚĐŽǀĞƌǁŝƚŚƉůĂƐƚŝĐƐŚĞĞƚƐ͘x EŽƚŝĨǇƚŚĞ'ĞŶĞƌĂůŽŶƚƌĂĐƚŽƌ͛ƐƐŝƚĞƐĂĨĞƚǇŽĨĨŝĐĞƌĂŶĚƐŝƚĞƐƵƉĞƌŝŶƚĞŶĚĞŶƚ͘x ZĞǀŝĞǁƚŚĞĞǆŝƐƚŝŶŐŚĞĂůƚŚĂŶĚƐĂĨĞƚǇƉůĂŶĨŽƌƌĞǀŝƐŝŽŶƐ͕ŝĨŶĞĐĞƐƐĂƌǇ͕ĂŶĚŚĂǀĞĂƉƉƌŽƉƌŝĂƚĞůǇƚƌĂŝŶĞĚƉĞƌƐŽŶŶĞůŽŶͲƐŝƚĞƚŽǁŽƌŬǁŝƚŚƚŚĞĂĨĨĞĐƚĞĚŵĂƚĞƌŝĂůƐ͕ŽŶĐĞĚŝƌĞĐƚĞĚďǇƚŚĞ'ĞŶĞƌĂůŽŶƚƌĂĐƚŽƌ͘ϵ͘ ^ŽŝůĂŶĚ'ƌŽƵŶĚǁĂƚĞƌDĂŶĂŐĞŵĞŶƚŽŵƉůĞƚŝŽŶZĞƉŽƌƚ͘^ŽŝůĂŶĚ'ƌŽƵŶĚǁĂƚĞƌDĂŶĂŐĞŵĞŶƚŽŵƉůĞƚŝŽŶZĞƉŽƌƚ;^'DZͿǁŝůůďĞƉƌĞƉĂƌĞĚƚŚĂƚƐƵŵŵĂƌŝǌĞƐƚŚĞƐŽŝůĂŶĚŐƌŽƵŶĚǁĂƚĞƌŵĂŶĂŐĞŵĞŶƚĂĐƚŝǀŝƚŝĞƐĂŶĚĂŶǇƐƵďƐĞƋƵĞŶƚŝŶǀĞƐƚŝŐĂƚŝǀĞĂŶĚƌĞŵŽǀĂůĂĐƚŝǀŝƚŝĞƐƚŚĂƚǁĞƌĞĐŽŵƉůĞƚĞĚĚƵƌŝŶŐƌĞĚĞǀĞůŽƉŵĞŶƚ͘dŚĞ^'DZǁŝůůƉƌĞƐĞŶƚĂĐŚƌŽŶŽůŽŐǇŽĨƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶĞǀĞŶƚƐ͕ĂƐƵŵŵĂƌǇŽĨĂŶĂůǇƚŝĐĂůĚĂƚĂ͕ĂĐŽƉǇŽĨĂůůŵĂŶŝĨĞƐƚƐĨƌŽŵƚŚĞƐŝƚĞ͕ĂŶĚĂĚĞƐĐƌŝƉƚŝŽŶŽĨĂůůƐŽŝůĂŶĚŐƌŽƵŶĚǁĂƚĞƌŵĂŶĂŐĞŵĞŶƚĂĐƚŝǀŝƚŝĞƐĂƚƚŚĞƐŝƚĞ͘dŚĞƌĞƉŽƌƚǁŝůůĂůƐŽĐŽŶƚĂŝŶůĂďŽƌĂƚŽƌǇĂŶĂůǇƚŝĐĂůƌĞƐƵůƚƐĂŶĚĨŝŐƵƌĞƐ͕ĂƐĂƉƉƌŽƉƌŝĂƚĞ͕ƚŽƉƌŽǀŝĚĞĚĞƚĂŝůƌĞŐĂƌĚŝŶŐƚŚĞĂŵŽƵŶƚĂŶĚƚǇƉĞŽĨĐŽŶƚĂŵŝŶĂƚŝŽŶĞŶĐŽƵŶƚĞƌĞĚ;ŝĨĂŶǇͿĚƵƌŝŶŐǀĂƌŝŽƵƐĂĐƚŝǀŝƚŝĞƐ͘dŚĞƌĞƉŽƌƚǁŝůůĂůƐŽƐƵŵŵĂƌŝǌĞĂŶǇƌĞƐŝĚƵĂůĐŽŶƚĂŵŝŶĂŶƚƐƚŚĂƚǁĞƌĞůĞĨƚŽŶƚŚĞƐŝƚĞĂĨƚĞƌĐŽŵƉůĞƚŝŽŶŽĨƌĞĚĞǀĞůŽƉŵĞŶƚĂĐƚŝǀŝƚŝĞƐĂŶĚĚŽĐƵŵĞŶƚƚŚĂƚƐŽŝůŚĂŶĚůŝŶŐƉƌŽĐĞĚƵƌĞƐǁĞƌĞŝŵƉůĞŵĞŶƚĞĚŝŶĂĐĐŽƌĚĂŶĐĞǁŝƚŚƚŚŝƐŵŝƚŝŐĂƚŝŽŶŵĞĂƐƵƌĞ͘dƌĂŶƐƉŽƌƚĂƚŝŽŶDŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdƌĂŶƐͲϭ͗ĞŵŽŶƐƚƌĂƚĞĚĞƋƵĂƚĞ^ŝŐŚƚŝƐƚĂŶĐĞĂƚWƌŽũĞĐƚƌŝǀĞǁĂǇƐ͘dŚĞĂƉƉůŝĐĂŶƚƐŚĂůůĚĞŵŽŶƐƚƌĂƚĞƚŽƚŚĞƐĂƚŝƐĨĂĐƚŝŽŶŽĨƚŚĞŝƚǇƚŚĂƚƚŚĞƐŝŐŚƚĚŝƐƚĂŶĐĞŝƐĂĚĞƋƵĂƚĞĂƚďŽƚŚƉƌŽũĞĐƚĚƌŝǀĞǁĂǇƐ͕ǁŚŝĐŚĐŽƵůĚŝŶĐůƵĚĞďƵƚŝƐŶŽƚůŝŵŝƚĞĚƚŽƚŚĞĨŽůůŽǁŝŶŐŵĞĂƐƵƌĞƐ͗WƌŝŽƌƚŽŝƐƐƵĂŶĐĞŽĨĞƌƚŝĨŝĐĂƚĞŽĨKĐĐƵƉĂŶĐǇƉƉůŝĐĂŶƚŽŶĨŝƌŵŝŵƉůĞŵĞŶƚĂƚŝŽŶŽƌƉůĂŶĨŽƌŝŵƉůĞŵĞŶƚĂƚŝŽŶ^^&WƵďůŝĐtŽƌŬƐĞƉĂƌƚŵĞŶƚ W'ϭϬK&ϭϬ ϴϬϬhhYhsEhWZK:dͲDDZW DŝƚŝŐĂƚŝŽŶDĞĂƐƵƌĞdŝŵŝŶŐͬ^ĐŚĞĚƵůĞ/ŵƉůĞŵĞŶƚĂƚŝŽŶZĞƐƉŽŶƐŝďŝůŝƚǇsĞƌŝĨŝĐĂƚŝŽŶDŽŶŝƚŽƌŝŶŐĐƚŝŽŶDŽŶŝƚŽƌŝŶŐZĞƐƉŽŶƐŝďŝůŝƚǇĂƚĞŽŵƉůĞƚĞĚx ŽŽƌĚŝŶĂƚŝŽŶǁŝƚŚƚŚĞŝƚǇƚŽĚĞĐƌĞĂƐĞƚŚĞƐƉĞĞĚůŝŵŝƚŽŶƵďƵƋƵĞǀĞŶƵĞƚŽϮϱŵƉŚ͘x ŽŽƌĚŝŶĂƚŝŽŶǁŝƚŚƚŚĞŝƚǇƚŽƌĞŵŽǀĞĂůůůŝŶĞͲŽĨͲƐŝŐŚƚŽďƐƚƌƵĐƚŝŽŶƐ;ǀĞŐĞƚĂƚŝŽŶ͕ƵƚŝůŝƚǇƉŽůĞƐĂŶĚƐŝŐŶďŽĂƌĚƐͿƚŽĐƌĞĂƚĞĐůĞĂƌƐŝŐŚƚůŝŶĞƐǁŝƚŚŝŶƚŚĞŝƚǇ͛ƐƌŝŐŚƚͲŽĨͲǁĂǇƚŽƚŚĞƐŽƵƚŚŽĨƚŚĞƉƌŽũĞĐƚƐŝƚĞ͘x ŽŽƌĚŝŶĂƚŝŽŶǁŝƚŚƚŚĞĂĚũĂĐĞŶƚƉƌŽƉĞƌƚǇƚŽƚŚĞƐŽƵƚŚ;ϳϮϬƵďƵƋƵĞǀĞŶƵĞͬW'ΘĞĂƐĞŵĞŶƚͿƚŽƉƵƐŚďĂĐŬƚŚĞĞǆŝƐƚŝŶŐŵĞƚĂůĨĞŶĐĞŽŶƚŚĞƐŽƵƚŚĞƌŶďŽƵŶĚĂƌǇŽĨƚŚĞƉƌŽũĞĐƚƐŝƚĞĂŶĚƌĞŵŽǀĞǀĞŐĞƚĂƚŝŽŶƚŽƉƌŽǀŝĚĞĂĐůĞĂƌǌŽŶĞƚŽƚŚĞƐŽƵƚŚŽĨƚŚĞƉƌŽũĞĐƚ͛ƐƐŽƵƚŚĞƌŶĚƌŝǀĞǁĂǇ͘ PG&E Gas and Electric Facilities Page 2 Public Attachment 1 – Gas Facilities There could be gas transmission pipelines in this area which would be considered critical facilities for PG&E and a high priority subsurface installation under California law. Care must be taken to ensure safety and accessibility. So, please ensure that if PG&E approves work near gas transmission pipelines it is done in adherence with the below stipulations. Additionally, the following link provides additional information regarding legal requirements under California excavation laws: https://www.usanorth811.org/images/pdfs/CA-LAW-2018.pdf 1. Standby Inspection: A PG&E Gas Transmission Standby Inspector must be present during any demolition or construction activity that comes within 10 feet of the gas pipeline. This includes all grading, trenching, substructure depth verifications (potholes), asphalt or concrete demolition/removal, removal of trees, signs, light poles, etc. This inspection can be coordinated through the Underground Service Alert (USA) service at 811. A minimum notice of 48 hours is required. Ensure the USA markings and notifications are maintained throughout the duration of your work. 2. Access: At any time, PG&E may need to access, excavate, and perform work on the gas pipeline. Any construction equipment, materials, or spoils may need to be removed upon notice. Any temporary construction fencing installed within PG&E’s easement would also need to be capable of being removed at any time upon notice. Any plans to cut temporary slopes exceeding a 1:4 grade within 10 feet of a gas transmission pipeline need to be approved by PG&E Pipeline Services in writing PRIOR to performing the work. 3. Wheel Loads: To prevent damage to the buried gas pipeline, there are weight limits that must be enforced whenever any equipment gets within 10 feet of traversing the pipe. Ensure a list of the axle weights of all equipment being used is available for PG&E’s Standby Inspector. To confirm the depth of cover, the pipeline may need to be potholed by hand in a few areas. Due to the complex variability of tracked equipment, vibratory compaction equipment, and cranes, PG&E must evaluate those items on a case-by-case basis prior to use over the gas pipeline (provide a list of any proposed equipment of this type noting model numbers and specific attachments). No equipment may be set up over the gas pipeline while operating. Ensure crane outriggers are at least 10 feet from the centerline of the gas pipeline. Transport trucks must not be parked over the gas pipeline while being loaded or unloaded. 4. Grading: PG&E requires a minimum of 36 inches of cover over gas pipelines (or existing grade if less) and a maximum of 7 feet of cover at all locations. The graded surface cannot exceed a cross slope of 1:4. 5. Excavating: Any digging within 2 feet of a gas pipeline must be dug by hand. Note that while the minimum clearance is only 24 inches, any excavation work within 24 inches of the edge of a pipeline must be done with hand tools. So to avoid having to dig a trench entirely with hand tools, the edge of the trench must be over 24 inches away. (Doing the math for a 24 inch PG&E Gas and Electric Facilities Page 3 Public wide trench being dug along a 36 inch pipeline, the centerline of the trench would need to be at least 54 inches [24/2 + 24 + 36/2 = 54] away, or be entirely dug by hand.) Water jetting to assist vacuum excavating must be limited to 1000 psig and directed at a 40° angle to the pipe. All pile driving must be kept a minimum of 3 feet away. Any plans to expose and support a PG&E gas transmission pipeline across an open excavation need to be approved by PG&E Pipeline Services in writing PRIOR to performing the work. 6. Boring/Trenchless Installations: PG&E Pipeline Services must review and approve all plans to bore across or parallel to (within 10 feet) a gas transmission pipeline. There are stringent criteria to pothole the gas transmission facility at regular intervals for all parallel bore installations. For bore paths that cross gas transmission pipelines perpendicularly, the pipeline must be potholed a minimum of 2 feet in the horizontal direction of the bore path and a minimum of 24 inches in the vertical direction from the bottom of the pipe with minimum clearances measured from the edge of the pipe in both directions. Standby personnel must watch the locator trace (and every ream pass) the path of the bore as it approaches the pipeline and visually monitor the pothole (with the exposed transmission pipe) as the bore traverses the pipeline to ensure adequate clearance with the pipeline. The pothole width must account for the inaccuracy of the locating equipment. 7. Substructures: All utility crossings of a gas pipeline should be made as close to perpendicular as feasible (90° +/- 15°). All utility lines crossing the gas pipeline must have a minimum of 24 inches of separation from the gas pipeline. Parallel utilities, pole bases, water line ‘kicker blocks’, storm drain inlets, water meters, valves, back pressure devices or other utility substructures are not allowed in the PG&E gas pipeline easement. If previously retired PG&E facilities are in conflict with proposed substructures, PG&E must verify they are safe prior to removal. This includes verification testing of the contents of the facilities, as well as environmental testing of the coating and internal surfaces. Timelines for PG&E completion of this verification will vary depending on the type and location of facilities in conflict. 8. Structures: No structures are to be built within the PG&E gas pipeline easement. This includes buildings, retaining walls, fences, decks, patios, carports, septic tanks, storage sheds, tanks, loading ramps, or any structure that could limit PG&E’s ability to access its facilities. 9. Fencing: Permanent fencing is not allowed within PG&E easements except for perpendicular crossings which must include a 16 foot wide gate for vehicular access. Gates will be secured with PG&E corporation locks. 10. Landscaping: Landscaping must be designed to allow PG&E to access the pipeline for maintenance and not interfere with pipeline coatings or other cathodic protection systems. No trees, shrubs, brush, vines, and other vegetation may be planted within the easement area. Only those plants, ground covers, grasses, flowers, and low-growing plants that grow unsupported to a maximum of four feet (4’) in height at maturity may be planted within the easement area. PG&E Gas and Electric Facilities Page 4 Public 11. Cathodic Protection: PG&E pipelines are protected from corrosion with an “Impressed Current” cathodic protection system. Any proposed facilities, such as metal conduit, pipes, service lines, ground rods, anodes, wires, etc. that might affect the pipeline cathodic protection system must be reviewed and approved by PG&E Corrosion Engineering. 12. Pipeline Marker Signs: PG&E needs to maintain pipeline marker signs for gas transmission pipelines in order to ensure public awareness of the presence of the pipelines. With prior written approval from PG&E Pipeline Services, an existing PG&E pipeline marker sign that is in direct conflict with proposed developments may be temporarily relocated to accommodate construction work. The pipeline marker must be moved back once construction is complete. 13. PG&E is also the provider of distribution facilities throughout many of the areas within the state of California. Therefore, any plans that impact PG&E’s facilities must be reviewed and approved by PG&E to ensure that no impact occurs which may endanger the safe operation of its facilities. PG&E Gas and Electric Facilities Page 5 Public Attachment 2 – Electric Facilities It is PG&E’s policy to permit certain uses on a case by case basis within its electric transmission fee strip(s) and/or easement(s) provided such uses and manner in which they are exercised, will not interfere with PG&E’s rights or endanger its facilities. Some examples/restrictions are as follows: 1. Buildings and Other Structures: No buildings or other structures including the foot print and eave of any buildings, swimming pools, wells or similar structures will be permitted within fee strip(s) and/or easement(s) areas. PG&E’s transmission easement shall be designated on subdivision/parcel maps as “RESTRICTED USE AREA – NO BUILDING.” 2. Grading: Cuts, trenches or excavations may not be made within 25 feet of our towers. Developers must submit grading plans and site development plans (including geotechnical reports if applicable), signed and dated, for PG&E’s review. PG&E engineers must review grade changes in the vicinity of our towers. No fills will be allowed which would impair ground-to- conductor clearances. Towers shall not be left on mounds without adequate road access to base of tower or structure. 3. Fences: Walls, fences, and other structures must be installed at locations that do not affect the safe operation of PG&’s facilities. Heavy equipment access to our facilities must be maintained at all times. Metal fences are to be grounded to PG&E specifications. No wall, fence or other like structure is to be installed within 10 feet of tower footings and unrestricted access must be maintained from a tower structure to the nearest street. Walls, fences and other structures proposed along or within the fee strip(s) and/or easement(s) will require PG&E review; submit plans to PG&E Centralized Review Team for review and comment. 4. Landscaping: Vegetation may be allowed; subject to review of plans. On overhead electric transmission fee strip(s) and/or easement(s), trees and shrubs are limited to those varieties that do not exceed 10 feet in height at maturity. PG&E must have access to its facilities at all times, including access by heavy equipment. No planting is to occur within the footprint of the tower legs. Greenbelts are encouraged. 5. Reservoirs, Sumps, Drainage Basins, and Ponds: Prohibited within PG&E’s fee strip(s) and/or easement(s) for electric transmission lines. 6. Automobile Parking: Short term parking of movable passenger vehicles and light trucks (pickups, vans, etc.) is allowed. The lighting within these parking areas will need to be reviewed by PG&E; approval will be on a case by case basis. Heavy equipment access to PG&E facilities is to be maintained at all times. Parking is to clear PG&E structures by at least 10 feet. Protection of PG&E facilities from vehicular traffic is to be provided at developer’s expense AND to PG&E specifications. Blocked-up vehicles are not allowed. Carports, canopies, or awnings are not allowed. 7. Storage of Flammable, Explosive or Corrosive Materials: There shall be no storage of fuel or combustibles and no fueling of vehicles within PG&E’s easement. No trash bins or incinerators are allowed. PG&E Gas and Electric Facilities Page 6 Public 8. Streets and Roads: Access to facilities must be maintained at all times. Street lights may be allowed in the fee strip(s) and/or easement(s) but in all cases must be reviewed by PG&E for proper clearance. Roads and utilities should cross the transmission easement as nearly at right angles as possible. Road intersections will not be allowed within the transmission easement. 9. Pipelines: Pipelines may be allowed provided crossings are held to a minimum and to be as nearly perpendicular as possible. Pipelines within 25 feet of PG&E structures require review by PG&E. Sprinklers systems may be allowed; subject to review. Leach fields and septic tanks are not allowed. Construction plans must be submitted to PG&E for review and approval prior to the commencement of any construction. 10. Signs: Signs are not allowed except in rare cases subject to individual review by PG&E. 11. Recreation Areas: Playgrounds, parks, tennis courts, basketball courts, barbecue and light trucks (pickups, vans, etc.) may be allowed; subject to review of plans. Heavy equipment access to PG&E facilities is to be maintained at all times. Parking is to clear PG&E structures by at least 10 feet. Protection of PG&E facilities from vehicular traffic is to be provided at developer’s expense AND to PG&E specifications. 12. Construction Activity: Since construction activity will take place near PG&E’s overhead electric lines, please be advised it is the contractor’s responsibility to be aware of, and observe the minimum clearances for both workers and equipment operating near high voltage electric lines set out in the High-Voltage Electrical Safety Orders of the California Division of Industrial Safety (https://www.dir.ca.gov/Title8/sb5g2.html), as well as any other safety regulations. Contractors shall comply with California Public Utilities Commission General Order 95 (http://www.cpuc.ca.gov/gos/GO95/go_95_startup_page.html)and all other safety rules. No construction may occur within 25 feet of PG&E’s towers. All excavation activities may only commence after 811 protocols has been followed. Contractor shall ensure the protection of PG&E’s towers and poles from vehicular damage by (installing protective barriers) Plans for protection barriers must be approved by PG&E prior to construction. 13. PG&E is also the owner of distribution facilities throughout many of the areas within the state of California. Therefore, any plans that impact PG&E’s facilities must be reviewed and approved by PG&E to ensure that no impact occurs that may endanger the safe and reliable operation of its facilities. Plan Review Team Land Management PGEPlanReview@pge.com PG&E Gas and Electric Facilities Page 1PG&E Gas and Electric Facilities Page 1 Public April 25, 2023 Kelsey Evans City of South San Francisco 315 Maple Ave South San Francisco, CA 94080 Re: 800 Dubuque Avenue Project 800 Dubuque Avenue, South San Francisco, CA Dear Kelsey: Thank you for giving us the opportunity to review the subject plans. The proposed 800 Dubuque Avenue Project is within the same vicinity of PG&E’s existing facilities that impact this property. The 800 Dubuque Avenue Project proposes to demolition of existing structures on the subject parcel. The applicant must contact the below resources to relocate or modify existing gas and electric service as needed. No structures are permitted to be built on any existing PG&E facilities to remain in place. Only plant lawns, flowers, low-profile grasses and low-growing herbaceous plants over any PG&E facilities within the subject parcels. Please contact the Building and Renovation Center (BRSC) for facility map requests by calling 1-877-743-7782 and PG&E’s Service Planning department at www.pge.com/cco for any modification or relocation requests, or for any additional services you may require. As a reminder, before any digging or excavation occurs, please contact Underground Service Alert (USA) by dialing 811 a minimum of 2 working days prior to commencing any work. This free and independent service will ensure that all existing underground utilities are identified and marked on-site. If you have any questions regarding our response, please contact me at Justin.Newell@pge.com. Sincerely, Justin Newell Land Management 916-594-4068 April 18, 2023 Christopher Espiritu, Senior Planner City of South San Francisco Economic and Community Development Department 315 Maple Street South San Francisco, California 94080 TRANSMITTED VIA E-MAIL ONLY christopher.espiritu@ssf.net Subject: SFO Comments on Initial Study/Mitigated Negative Declaration: 800 Dubuque Avenue Project, South San Francisco, California San Francisco International Airport (SFO or the Airport) staff have reviewed the Initial Study/Mitigated Negative Declaration (IS/MND) for the 800 Dubuque Avenue Project (the Proposed Project), located in the City of South San Francisco. We appreciate this opportunity to provide comments on the IS/MND. As described in the IS/MND, the Proposed Project is located at 800 Dubuque Avenue (Assessor’s Parcel Number 015-021-030), bordered by Dubuque Avenue and U.S. Highway 101 on the west and by the Caltrain right-of-way on the east; it is currently developed with two one-story buildings and one two-story building containing office/research and development (life science) uses and associated surface parking. The Proposed Project consists of demolishing the three existing buildings and constructing three new office/research and development buildings containing a total of approximately 900,000 gross square feet and four levels of below-grade parking with a total of 1,335 parking spaces. The north building would be the tallest at approximately 195 feet above grade; the west and south buildings would be approximately 179 and 130 feet above grade, respectively. Including the mechanical penthouse on the tallest building, the maximum height of the Proposed Project would be approximately 215 feet above grade. The Proposed Project would include an event center, food/beverage uses, a fitness center, and a bicycle storage room. The three buildings would be connected by a two-story terrace featuring a central plaza and courtyard. The Proposed Project site is inside Airport Influence Area B as defined by the Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport (SFO ALUCP). The Proposed Project site would be located outside the 65-decibel (dBA) Community Noise Equivalent Level (CNEL) contour and the Safety compatibility zones, and therefore would not appear to be inconsistent with the Noise and Safety Compatibility policies adopted in the SFO ALUCP. However, many airport departure procedures currently are designed to ascend over the project area, and overnight uses in particular could experience some noise disturbances from aircraft departures. As described in Exhibit IV-17 of the ALUCP (see Attachment), the critical aeronautical surface at the Proposed Project location is at an elevation of approximately 860 feet above mean sea level (AMSL) as defined from the origin of the North American Vertical Datum of 1988 (NAVD88). Given that the ground elevation at the Proposed Project site is around 19 feet AMSL (NAVD88), the heights of the buildings as currently defined (195, 179, and 130 feet above ground level) would be below the critical aeronautical surfaces and the Proposed Project would not appear to be incompatible with the Airspace Compatibility Policies of the SFO ALUCP, subject to the issuance of a Determination of No Hazard from the Federal Aviation Administration (see below) for any proposed structures and determinations from the City/County Association of Governments of San Mateo County as the designated Airport Land Use Commission. Christopher Espiritu, City of South San Francisco April 18, 2023 Page 2 of 2 The Project Description section on page 3 of the IS/MND includes the following language: “The north building would be the tallest at approximately 195 feet above grade, and the west and south buildings would be approximately 179 and 130 feet above grade, respectively (including the mechanical penthouses).” Based on the sections and elevations provided in Figures 5 through 7 of the IS/MND, the elevations of the north, west, and south buildings including the mechanical penthouses are approximately 215, 199, and 147 feet AMSL, respectively. We note that in the Initial Study Checklist for the Proposed Project, the height limitations described in the Hazards and Hazardous Materials section are not characterized accurately. The section states: “Development on the project site is limited to maximum heights of 261 feet above mean sea level but could be modified through consultation with the Federal Aviation Administration (FAA).” The “maximum heights” described in the previous sentence are FAA obstruction evaluation surfaces described in 14 Code of Federal Regulations Part 77 Section 19, of which penetrations are considered obstructions, but not necessarily hazards to air navigation. Higher structures could be permissible through consultation with the FAA as long as the structures do not conflict with the critical aeronautical surfaces of the SFO ALUCP. Thus, the Proposed Project does not appear to be inconsistent with both height limitations (FAA and ALUCP critical aeronautical surface) identified in the SFO ALUCP, pending an FAA determination of no hazard. This determination does not negate the requirement for the Proposed Project sponsor to undergo Federal Aviation Administration review as described in 14 Code of Federal Regulations Part 77 for both (1) the permanent structures and (2) any temporary cranes or other equipment taller than the permanent buildings which would be required to construct those structures. * * * The Airport appreciates your consideration of these comments. If I can be of assistance, please do not hesitate to contact me at (650) 821-6678 or at nupur.sinha@flysfo.com. Sincerely, Nupur Sinha Director of Planning and Environmental Affairs San Francisco International Airport P.O. Box 8097 San Francisco, California 94128 Attachment cc: Susy Kalkin, ALUC Audrey Park, SFO Chris DiPrima, SFO THE CITY/COUNTY ASSOCIATION OF GOVERNMENTS OF SAN MATEO COUNTY NOVEMBER 2012 Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport [IV-34] Airport/Land Use Compatibility Policies and associated with human disease of varying severity. b. Biosafety Level 3 practices, safety equipment, and facility design and construction are applicable to clinical, diagnostic, teaching, research, or production facilities in which work is done with indigenous or exotic agents with a potential for respiratory transmission, and which may cause serious and potentially lethal infection. c. Biosafety Level 4 practices, safety equipment, and facility design and construction are applicable for work with dangerous and exotic agents that pose a high individual risk of life-threatening disease, which may be transmitted via the aerosol route and for which there is no available vaccine or therapy. 4.5 Airspace Protection The compatibility of proposed land uses with respect to airspace protection shall be evaluated in accordance with the policies set forth in this section. These policies are established with a twofold purpose: 1. To protect the public health, safety, and welfare by minimizing the public’s exposure to potential safety hazards that could be created through the construction of tall structures. 2. To protect the public interest in providing for the orderly development of SFO by ensuring that new development in the Airport environs avoids compromising the airspace in the Airport vicinity. This avoids the degradation in the safety, utility, efficiency, and air service capability of the Airport that could be caused by the attendant need to raise visibility minimums, increase minimum rates of climb, or cancel, restrict, or redesign flight procedures. 4.5.1 FEDERAL REGULATIONS REGARDING TALL STRUCTURES 14 Code of Federal Regulations (CFR) Part 77, Safe, Efficient Use and Preservation of the Navigable Airspace, governs the FAA’s review of proposed construction exceeding certain height limits, defines airspace obstruction criteria, and provides for FAA aeronautical studies of proposed construction. Appendix F describes the FAA airspace review process and the extent of FAA authority related to airspace protection. 4.5.2 PART 77, SUBPART B, NOTIFICATION PROCESS Federal regulations require any person proposing to build a new structure or alter an existing structure with a height that would exceed the elevations described in CFR Part 77, Subpart B, Section 77.9, to prepare an FAA Form 7460-1, Notice of Proposed Construction or Alteration, and submit the notice to the FAA. The regulations apply to buildings and other structures or portions of structures, such as mechanical equipment, flag poles, and other projections that may exceed the aforementioned elevations. THE CITY/COUNTY ASSOCIATION OF GOVERNMENTS OF SAN MATEO COUNTY NOVEMBER 2012 Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport Airport/Land Use Compatibility Policies [IV-35] Exhibit IV-10 depicts the approximate elevations at which the 14 CFR Part 77 notification requirements would be triggered; see Exhibit IV-11 for a close-up view of the northern half and Exhibit IV-12 for a close-up view of the southern half of the area. These exhibits are provided for informational purposes only. Official determinations of the areas and elevations within which the federal notification requirements apply are subject to the authority of the FAA. The FAA is empowered to require the filing of notices for proposed construction based on considerations other than height. For example, in some areas of complex airspace and high air traffic volumes, the FAA may be concerned about the potential for new construction of any height to interfere with electronic navigation aids. In these areas, the FAA will want to review all proposed construction projects. The FAA has developed an on-line tool for project sponsors to use in determining whether they are required to file a Notice of Proposed Construction or Alteration. Sponsors of proposed projects are urged to refer to this website to determine whether they are required to file Form 7460-1 with the FAA: https://oeaaa.faa.gov/oeaaa/external/gisTools/gisAction.jsp?action=showNoNoticeRequiredToolForm 4.5.3 AIRSPACE MAPPING Part 77, Subpart C, establishes obstruction standards for the airspace around airports including approach zones, conical zones, transitional zones, and horizontal zones known as “imaginary surfaces.” Exhibit IV-13 depicts the Part 77 Civil Airport Imaginary Surfaces at SFO. The imaginary surfaces rise from the primary surface, which is at ground level immediately around the runways. The surfaces rise gradually along the approach slopes associated with each runway end and somewhat more steeply off the sides of the runways. The FAA considers any objects penetrating these surfaces, whether buildings, trees or vehicles travelling on roads and railroads, as obstructions to air navigation. Obstructions may occur without compromising safe air navigation, but they must be marked, lighted, and noted on aeronautical publications to ensure that pilots can see and avoid them. Close-up views of the north and south sides of the Part 77 surfaces are provided in Exhibit IV-14 and Exhibit IV-15, respectively. Additionally, Exhibit IV-16 provides an illustration of the outer approach and transitional surfaces located on the southeast side of the Part 77 surfaces. Together with its tenant airlines, SFO has undertaken a mapping effort to illustrate the critical aeronautical surfaces that protect the airspace required for multiple types of flight procedures such as those typically factored into FAA aeronautical studies, as shown on Exhibit IV-17 and Exhibit IV-18. These aeronautical surfaces include those established in accordance with FAA Order 8260.3B, U.S. Standard for Terminal Instrument Procedures (TERPS), and a surface representing the airspace required for One-Engine Inoperative (OEI) departures from Runway 28L (to the west through the San Bruno Gap).16 The exhibits depict the lowest elevations from the combination of the OEI procedure surface and all TERPS surfaces. The surfaces are defined with Required Obstacle Clearance (ROC) criteria to ensure safe separation of aircraft using the procedures from the underlying obstacles. Any proposed structures penetrating these surfaces are likely to receive Determinations of Hazard (DOH) from the FAA through the 7460-1 aeronautical study process. These surfaces indicate the maximum height at which structures can be considered compatible with Airport operations. 16 See Appendix F, Section F.3.2 for a discussion of one-engine inoperative procedures. 28038028028010110110110113582821182ROLLINS RDHILLSIDE BLVDE 3RD AVECALIFORNIA DRB A Y S HORE BLVDE L C A M IN O R E A L MISSION RD87TH STAIRPORT BLVDC ALLA N B L V D GRAND AVEMILLER AVESOUTHGATE AVETROUSDALE DRSHARP PARK RDSNEATH LNPARK WYCRESPI DRFLEE T W O O D DRMURCHISON DRSULLIVAN AVEST FRANCIS BLVDJOHN DALY BLVDRALSTON AVEHELEN DRARROYO DRS AIRP O R T B L V D S K Y L IN E B O U LEVARDGENEVA AVEN HUMBOL DT STFASSLER AVEBAYSH O R E H W Y TILTON AVEN AM PHLETT BLVDN M C D O N N E L L R D S T A T E HIG H W A Y 3 5 HUNTI N G T O N A V E LIN DA MAR BLVDHICKEY BLVDSHAW R D ADELINE DRE 4TH AVETER R A N OVA B L VD HILLSIDE DRLINDEN AVELOMITA AVES SPRUCE AVESERRAMONTE BLVDCHESTNUT AVEN DELA WA R E ST BELLEVUE AVEE GRAND AVES NO R F OL K ST HOLLY AVECARMELITA AVES LINDEN AVEUTAH AVELOYOLA DRRAY DRDWIGHT RD OCCIDE N T A L A V EN SAN MATEO DRC R E S T M O O R D RJENEVEIN AVEM A D I S O N A V E MILLBRAE AVESISTER CITIES BLVDCRYSTAL SPRINGS RDW SAN BRUNO AVESEBA S TI A N D R ALTA MESA DRL E R IDA WYPARK PLAZA DR PARK BLVDJ U N IP E R O S E R R A B L V D ALICANTE DRMAG N OLI A A V E SAN MATEO AVEBROADWAYHOFFMAN STRICHMOND DRSEVILLE DRMONTEREY RDRIDGE W O O D D R EASTON DREARL AVESAN A N T O NI O A V E SHARON AVELARKSPUR DRG A T E W A Y DREL CERRITO AVECHATEAU DRWESTLAKE AVEBELLA VISTA DRLITTLEFIELD AVECROC K E R A V E E MARKET STLINCOLN AVEOAKS DREL CAMINO REALODDSTAD BLVDHUNT D R SUMMIT DREUCALYPTUS AVEHELEN DRS T A T E H IG H W A Y 35 W SAN BRUNO AVEEL CAMINO REALSNEATH LNMAGNOLIA AVEHILLSIDE BLVD E 3RD AVEPacificaPacificaDaly CityDaly CitySan BrunoSan BrunoBrisbaneBrisbaneSan MateoSan MateoColmaColmaHillsboroughHillsboroughSouth San FranciscoSouth San FranciscoMillbraeMillbraeBurlingameBurlingameSan FranciscoSan FranciscoFoster CityFoster CityBroadmoorBroadmoorMontaraMontaraSan Pedro Valley County ParkSan Pedro Valley County ParkSan Bruno Mt State & Cnty ParkSan Bruno Mt State & Cnty ParkGolden Gate National Rec AreaGolden Gate National Rec AreaMcNee Ranch State ParkMcNee Ranch State ParkSan Andreas LakeSan Andreas Lake1. This map is intended for informational and conceptualplanning purposes, generally representing the aeronauticalsurfaces considered most critical by San FranciscoInternational Airport (SFO) and its constituent airlines. It doesnot represent actual survey data, nor should it be used as thesole source of information regarding compatibility with airspaceclearance requirements in the development of data for an FAAForm 7460-1, Notice of Proposed Construction or Alteration.SFO does not certify its accuracy, information, or title to theproperties contained in this plan. SFO does make anywarrants of any kind, express or implied, in fact or by law, withrespect to boundaries, easements, restrictions, claims,overlaps, or other encumbrances affecting such properties.2. This map does not replace the FAA's obstruction evaluation /airport airspace analysis (OE/AAA) review process. Proposingconstruction at elevations and heights that are lower than thecritical aeronautical surfaces shown on this map, (a) does notrelieve the construction sponsor of the obligation to file an FAAForm 7460-1, and (b) does not ensure that the proposal will beacceptable to the FAA, SFO, air carriers, or other agencies orstakeholders. SFO, San Mateo County, and local authoritieshaving jurisdiction reserve the right to re-assess, review, andseek modifications to projects that may be consistent with thiscritical aeronautical surfaces map but that through the FAAOE/AAA process are found to have unexpected impacts to thesafety or efficiency of operations at SFO.Notes:Exhibit IV-17CRITICAL AERONAUTICAL SURFACES-- NORTHWEST SIDEComprehensive Airport Land Use Planfor the Environs of San Francisco International AirportC/CAGCity/County Association of Governmentsof San Mateo County, CaliforniaMunicipal BoundaryRoadFreewayRailroadAirport PropertyBART StationCALTRAIN StationRegional Park or Recreation AreaSources: San Francisco International Airport, JacobsConsultancy, and Planning Technology Inc., 200900.510.25MilesNORTHGround level(Terrain)Elevation of critical aeronautical surfaces, feetAbove Mean Sea Level (AMSL), North AmericanVertical Datum of 1988 (NAVD88)100Height of Critical Aeronautical Surfaces, Feet AboveGround Level (AGL)LEGENDElevation of terrain, feet AMSLCriticalaeronauticalsurfacesAIRPORTMean sea levelElevation, feet AMSL100200300400Elevation of critical aeronautical surfaces, feet AMSL (represented on plan with contours)Height of critical aeronautical surfaces,feet AGL (represented on plan with color gradient)Calculated as - =0Ground level(Terrain)ABCABCABCAC35 and lower35- 6565 - 100100 - 150150 and more THE CITY/COUNTY ASSOCIATION OF GOVERNMENTS OF SAN MATEO COUNTY NOVEMBER 2012 Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport Airport/Land Use Compatibility Policies [IV-55] Exhibit IV-19, which is provided for information purposes only, depicts a profile view of the lowest critical airspace surfaces along the extended centerline of Runway 10L-28R – the TERPS Obstacle Departure Procedure (ODP) surface, representing standard all-engines departures, and the approximate OEI surface developed by SFO through independent study in consultation with the airlines serving SFO. The exhibit also shows the terrain elevation beneath the airspace surfaces and various aircraft approach and departure profiles, based on varying operating assumptions. The exhibit illustrates a fundamental principle related to the design of airspace protection surfaces. The surfaces are always designed below the actual aircraft flight profile which they are designed to protect, thus providing a margin of safety. Note that the ODP climb profile is above the ODP airspace surface, and the OEI climb profile is above the OEI airspace surface. 4.5.4 AIRSPACE PROTECTION POLICIES The following airspace protection policies (AP) shall apply to the ALUCP. AP-1 COMPLIANCE WITH 14 CFR PART 77, SUBPART B, NOTICE OF PROPOSED CONSTRUCTION OR ALTERATION AP-1.1 Local Government Responsibility to Notify Project Sponsors Local governments should notify sponsors of proposed projects at the earliest opportunity to file Form 7460-1, Notice of Proposed Construction or Alteration, with the FAA for any proposed project that would exceed the FAA notification heights, as shown approximately on Exhibit IV-10. Under Federal law, it is the responsibility of the project sponsor to comply with all notification and other requirements described in 14 CFR Part 77. This requirement applies independent of this ALUCP. AP-1.2 FAA Aeronautical Study Findings Required Before Processing Development Application The sponsor of a proposed project that would exceed the FAA notification heights, as shown approximately on Exhibit IV-10, shall present to the local government permitting agency with his or her application for a development permit, a copy of the findings of the FAA’s aeronautical study, or evidence demonstrating that he or she is exempt from having to file an FAA Form 7460-1. It is the responsibility of the local agency to consider the FAA determination study findings as part of its review and decision on the proposed project. AP-2 COMPLIANCE WITH FINDINGS OF FAA AERONAUTICAL STUDIES Project sponsors shall be required to comply with the findings of FAA aeronautical studies with respect to any recommended alterations in the building design and height and any recommended marking and lighting of their structures for their proposed projects to be deemed consistent with this ALUCP. THE CITY/COUNTY ASSOCIATION OF GOVERNMENTS OF SAN MATEO COUNTY NOVEMBER 2012 Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport Airport/Land Use Compatibility Policies [IV-59] AP-3 MAXIMUM COMPATIBLE BUILDING HEIGHT In order to be deemed consistent with the ALUCP, the maximum height of a new building must be the lower of (1) the height shown on the SFO critical aeronautical surfaces map (Exhibits IV-17 and IV-18), or (2) the maximum height determined not to be a “hazard to air navigation” by the FAA in an aeronautical study prepared pursuant to the filing of Form 7460-1. For the vast majority of parcels, the height limits established in local zoning ordinances are lower than the critical airspace surfaces. In those cases, the zoning district height regulations will control. Compliance with the zoning district height and the SFO critical aeronautical surfaces map, however, does not relieve the construction sponsor of the obligation to file a FAA Form 7460-1 Notice of Proposed Construction or Alteration, if required, and to comply with the determinations resulting from the FAA’s aeronautical study. For a project to be consistent with this ALUCP, no local agency development permits shall be issued for any proposed structure that would penetrate the aeronautical surfaces shown on Exhibits IV-17 and IV-18 or the construction of which has not received a Determination of No Hazard from the FAA, or which would cause the FAA to increase the minimum visibility requirements for any instrument approach or departure procedure at the Airport. AP-4 OTHER FLIGHT HAZARDS ARE INCOMPATIBLE Proposed land uses with characteristics that may cause visual, electronic, or wildlife hazards, particularly bird strike hazards, to aircraft taking off or landing at the Airport or in flight are incompatible in Area B of the Airport Influence Area. They may be permitted only if the uses are consistent with FAA rules and regulations. Proof of consistency with FAA rules and regulations and with any performance standards cited below must be provided to the Airport Land Use Commission (C/CAG Board) by the sponsor of the proposed land use action. Specific characteristics that may create hazards to aircraft in flight and which are incompatible include: (a) Sources of glare, such as highly reflective buildings or building features, or bright lights, including search lights or laser displays, which would interfere with the vision of pilots making approaches to the Airport. (b) Distracting lights that that could be mistaken by pilots on approach to the Airport for airport identification lighting, runway edge lighting, runway end identification lighting, or runway approach lighting. (c) Sources of dust, smoke, or water vapor that may impair the vision of pilots making approaches to the Airport. (d) Sources of electrical interference with aircraft or air traffic control communications or navigation equipment, including radar. (e) Land uses that, as a regular byproduct of their operations, produce thermal plumes with the potential to rise high enough and at sufficient velocities to interfere with the control of aircraft in THE CITY/COUNTY ASSOCIATION OF GOVERNMENTS OF SAN MATEO COUNTY NOVEMBER 2012 Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport [IV-60] Airport/Land Use Compatibility Policies flight. Upward velocities of 4.3 meters (14.1 feet) per second at altitudes above 200 feet above the ground shall be considered as potentially interfering with the control of aircraft in flight.17 (f) Any use that creates an increased attraction for wildlife, particularly large flocks of birds, that is inconsistent with FAA rules and regulations, including, but not limited to, FAA Order 5200.5A, Waste Disposal Sites On or Near Airports, FAA Advisory Circular 150/5200-33B, Hazardous Wildlife Attractants On or Near Airports, and any successor or replacement orders or advisory circulars. Exceptions to this policy are acceptable for wetlands or other environmental mitigation projects required by ordinance, statute, court order, or Record of Decision issued by a federal agency under the National Environmental Policy Act. 4.5.5 iALP AIRSPACE TOOL In consultation with C/CAG, SFO developed the iALP Airspace Tool, a web-based, interactive tool to evaluate the relationship of proposed buildings with the Airport’s critical airspace surfaces. The iALP Airspace Tool is designed to assist planners, developers, and other interested persons with the implementation of the airspace protection policies of the SFO ALUCP. The tool helps users determine: (1) the maximum allowable building height at a given site, and/or (2) whether a building penetrates a critical airspace surface, and by how much, given the proposed building height. A more detailed description of the iALP Airspace Tool and a tutorial explaining how to use it is presented in Appendix J. Use of this tool, however, does not relieve a project sponsor of the duty to comply with all federal regulations, including the obligation to file Form 7460-1, Notice of Proposed Construction or Alteration, with the FAA. 17 This is a threshold established by the California Energy Commission in its review of power plant licensing applications. See Blythe Solar Power Project: Supplemental Staff Assessment, Part 2,. CEC-700-2010-004-REV1-SUP-PT2, July 2010. California Energy Commission. Docket Number 09-AFC-6, p. 25. This criterion is based on guidance established by the Australian Government Civil Aviation Authority (Advisory Circular AC 139-05(0), June 2004). The FAA’s Airport Obstructions Standards Committee (AOSC) is studying this matter but has not yet issued specific guidance. From:Frost, Erik@DOC <Erik.Frost@conservation.ca.gov> Sent:Tuesday, April 25, 2023 12:23 PM To:Evans, Kelsey <kelsey.evans@ssf.net> Subject:RE: NOA/NOI - 800 Dubuque Avenue Project - South San Francisco, CA Hello Kelsey Evans, The California Geological Survey (CGS) has reviewed the Initial Study & Mitigated Negative Declaration (IS/MND) for the proposed 800 Dubuque Avenue project. The IS/MND incorrectly states “the project site is not within a mapped liquefaction hazard zone.” The CGS has prepared a Seismic Hazard Zone Report and Earthquake Zone of Required Investigation Map for the San Francisco South quadrangle, and the project site is in fact located within a zone of required investigation for liquefaction. However, the IS/MND goes on to state that liquefaction potential was assessed in a geotechnical investigation. For future reference, Earthquake Zones of Required Investigation can be reviewed here: https://maps.conservation.ca.gov/cgs/EQZApp/app/ Associated maps, report, and GIS data are available here: https://maps.conservation.ca.gov/cgs/informationwarehouse/index.html?map=regulatory maps Please let me know if you have any questions. Erik Dr. Erik Frost Senior Engineering Geologist | Seismic Hazards Program i TABLE OF CONTENTS page Introduction to this Document.......................................................................................................... 1 Public Review..................................................................................................................................... 1 Project Information........................................................................................................................... 1 Mitigated Negative Declaration......................................................................................................13 Lead Agency Determination............................................................................................................ 21 Initial Study Checklist ...................................................................................................................... 22 Environmental Factors Potentially Affected ............................................................................ 22 Evaluation of Environmental Impacts...................................................................................... 22 Aesthetics................................................................................................................................. 23 Agricultural and Forest Resources............................................................................................ 26 Air Quality................................................................................................................................. 27 Biological Resources................................................................................................................. 36 Cultural Resources.................................................................................................................... 39 Energy....................................................................................................................................... 41 Geology and Soils.....................................................................................................................44 Greenhouse Gas Emissions ...................................................................................................... 4 8 Hazards and Hazardous Materials............................................................................................ 52 Hydrology and Water Quality................................................................................................... 59 Land Use and Planning............................................................................................................. 64 Mineral Resources.................................................................................................................... 65 Noise......................................................................................................................................... 66 Population and Housing........................................................................................................... 68 Public Services..........................................................................................................................69 Recreation................................................................................................................................ 70 Transportation.......................................................................................................................... 71 Tribal Cultural Resources.......................................................................................................... 75 Utilities and Service Systems.................................................................................................... 76 Wildfire..................................................................................................................................... 80 Mandatory Findings of Significance......................................................................................... 81 Document Preparers....................................................................................................................... 82 Sources............................................................................................................................................ 82 ii page TABLES Table 1: Daily Regional Air Pollutant Emissions for Construction...................................................29 Table 2: Regional Air Pollutant Emissions for Operations............................................................... 31 Table 3: Construction and Operation Risk.......................................................................................33 Table 4: Cumulative Community Risk..............................................................................................3 5 Table 5: Construction and Operational Energy Usage .................................................................... 42 Table 6: Greenhouse Gas Emissions ................................................................................................51 FIGURES Figure 1: Project Location.................................................................................................................. 6 Figure 2: Existing Conditions ............................................................................................................. 7 Figure 3: Site Plan.............................................................................................................................. 8 Figure 4: Visual Model....................................................................................................................... 9 Figure 5: Building Sections .............................................................................................................. 10 Figure 6: Elevation, North and East................................................................................................. 11 Figure 7: Elevation, South and West............................................................................................... 1 2 ATTACHMENTS Attachment A: Air Quality & Greenhouse Gas Assessment Attachment B: Cultural Records Search, Native American Heritage Commission Response Attachment C: Energy Calculations Attachment D: Transportation Analysis 800 Dubuque Avenue Project Initial Study/MND Page 1 INTRODUCTION TO THIS DOCUMENT This document serves as the Initial Study and Mitigated Negative Declaration for the 800 Dubuque Avenue project, prepared in accordance with the California Environmental Quality Act (CEQA; Public Resources Code Sections 15000 et seq.). Per CEQA Guidelines (Section 15070), a Mitigated Negative Declaration can be prepared to meet the requirements of CEQA review when the Initial Study identifies potentially significant environmental effects, but revisions in the project and/or incorporation of mitigation measures agreed to by the applicant would avoid the effects or mitigate the effects to a point where clearly no significant effects would occur and there is no substantial evidence in light of the whole record that the project as revised may have significant effect on the environment. This document is organized in three sections as follows: x Introduction and Project Information. This section introduces the document and presents the project description including location, setting, and specifics of the lead agency and contacts. x Mitigated Negative Declaration. This section lists the impacts and mitigation measures identified in the Initial Study and proposes findings that would allow adoption of this document as the CEQA review document for the proposed project. x Initial Study Checklist. This section discusses the CEQA environmental topics and checklist questions and identifies the potential for impacts and proposed mitigation measures to avoid these impacts. Full project materials are available for review upon request from the Planning Department at City of South San Francisco (see contact info below). PUBLIC REVIEW This Initial Study will be circulated for a 30-day public review period. Comments may be submitted in writing by email or regular mail to the following address: Christopher Espiritu, Senior Planner City of South San Francisco Economic & Community Development Department 315 Maple Avenue South San Francisco, CA 94083-0711 Phone: 650-877-8535 Email: Christopher.Espiritu@ssf.net PROJECT INFORMATION All figures for the project information are included together on pages 6 through 12. PROJECT ENTITLEMENTS Development of the project would require the following approvals from the City of South San Francisco: Conditional Use Permit, based on a Community Benefits Agreement, to exceed the FAR that would be allowed by right, Design Review, and a Transportation Demand Management Program. Page 2 800 Dubuque Avenue Project Initial Study/MND The project is required to comply with Municipal Regional Permit requirements related to stormwater pollution prevention. LEAD AGENCY City of South San Francisco Economic & Community Development Department 315 Maple Avenue South San Francisco, CA 94083-0711 CONTACT PERSON Christopher Espiritu, Senior Planner City of South San Francisco Economic & Community Development Department 315 Maple Avenue South San Francisco, CA 94083-0711 Phone: 650-877-8535 Email: Christopher.Espiritu@ssf.net PROJECT SPONSOR Dubuque Center, L.P. Contact: Justine Nielsen, SVP of Development, IQHQ 674 Via De La Valle Suite 206 Solana Beach, CA 92075 Phone: 858-779-1111 PROJECT LOCATION AND EXISTING USES The 5.89-acre project site (Assessor’s Parcel Number 015-021-030) is located in the City of South San Francisco, California at 800 – 890 Dubuque Avenue. It is bordered by Dubuque Avenue and the U.S. 101 highway on the west and the Caltrain right-of-way to the east. The adjacent property to the north is currently occupied by a Costco. The property immediately to the south supports PG&E transmission lines and surface parking, and further to the south is a now-vacant former Lowe’s Home Improvement store, currently used as a construction staging site. Figure 1 shows the project location. Figure 2 shows the existing conditions. The project site is currently developed with two one-story buildings and one two-story building, totaling 113,595 square feet of office/R&D (life science) use and associated surface parking. The project site is within ½ mile of the South San Francisco Caltrain station. SamTrans provides bus service primarily on the west side of U.S. 101, with some service on Oyster Point Boulevard to the north, and commute.org provides shuttle service from the Caltrain station to/from the BART and WETA ferry station. The site is relatively level, with varying elevations above mean sea level of approximately 19.4 to 25.6 feet. The depth to groundwater is approximately 8.5 feet below ground surface and the groundwater flow direction is to the southeast, generally toward the San Francisco Bay. The project site does not appear on any regulatory lists for contaminated sites and there is no indication of migration of contamination from nearby contaminated sites or warrant for regulatory requirements at this site. 800 Dubuque Avenue Project Initial Study/MND Page 3 GENERAL PLAN DESIGNATION / ZONING General Plan Designation: East of 101 Transit Core Zoning: East of 101 Transit Core (ETC) SURROUNDING LAND USES The project site is located between the Caltrain right-of-way to the east and U.S. 101 to the west. The northern adjacent property contains a Costco store, and the southern adjacent properties contain PG&E transmission lines with surface parking and a vacant large-format retail building (formerly Lowe’s). The project site is at the western edge of the East of 101 area, which is a large employment area including industrial, office, research and development, and commercial uses. To the west, across Dubuque Avenue is U.S. 101, with commercial and multi-family residential uses fronting along Airport Boulevard on the other side of the highway and residential neighborhoods beyond. PROJECT DESCRIPTION Overview and Building Massing The proposed project would involve demolition of the three existing buildings and construction of three new office / research and development (R&D) buildings. The project would be comprised of three buildings, the north, south, and west buildings, for a total of up to approximately 900,000 gross square feet. The north building would be the tallest at approximately 195 feet above grade, and the west and south buildings would be approximately 179 and 130 feet above grade, respectively (including the mechanical penthouses). The project would include an approximately 7,500 square foot event center, approximately 6,600 square feet of food/beverage uses, an approximately 3,300 square foot bike room, and an approximately 7,200 square foot fitness center. The buildings would be connected by a two-story terrace, featuring a central plaza and courtyard that would provide open space and gathering and rest areas. The project is intended to be a mix of R&D space and offices. Based on an average office/R&D project employment density of 300 gross square feet per employee, a maximum of approximately 3,000 employees would be anticipated. Note that in parallel with this analysis, the project may undergo minor design revisions that would result in differences in building square footage and other minor details. This analysis presents the largest reasonable assumptions for development of the project such that the actual project will fall within this analysis. The west building would be oriented along Dubuque Avenue, with the northwest side angled to draw pedestrians towards the courtyard. The north and south buildings would be oriented along the internal roadways. Ground floor facades would have clear glazing for transparent building entries. Building entries would be protected by recessed entry portals that provide shelter from the wind and rain. The ShapeSSF General Plan 2040 designates the project site as East of 101 Transit Core with a maximum FAR of 1.0 by right, up to a maximum of 2.5 with the payment of a Community Benefits Fee, and up to 8.0 with a Community Benefits Agreement. The proposed project would have a FAR of approximately 3.33, which would require a Conditional Use Permit together with approval of a Community Benefits Agreement. The site is zoned East of 101 Transit Core, under which office and R&D uses are permitted. Figure 3 shows the site plan. Figure 4 shows a visual model of the project. Figure 5 includes building cross sections. Figures 6 and 7 show the proposed building elevations. Page 4 800 Dubuque Avenue Project Initial Study/MND Access & Parking The project site is accessible by automobile, train, and bus, and would include on-site facilities for pedestrians and bikes. Rail: The project site is located less than ½ mile from the South San Francisco Caltrain Station, part of a regional rail corridor that provides connectivity between San Francisco and Gilroy. The project site is also located approximately 2.5 and 3.0 miles from the San Bruno and South San Francisco BART Stations respectively, which are served by BART’s Red and Yellow Lines. Bus: SamTrans services the area through its 130, 141, 292, and 397 lines which stop at Airport Blvd. and Linden Avenue. Automobile/Truck: Vehicular access to the project site would remain from Dubuque Avenue. The main entrance to the project would be located on the northwestern corner of the site. A perimeter road would encircle the buildings leading to the below-grade parking areas. A secondary access point from Dubuque Avenue would be located on the southwestern portion of the site. The sidewalk on the east perimeter road would be maintained and the road would function as a shared space between vehicles, bicycles, and pedestrians. Bicycle and Pedestrian Access: A sidewalk runs along the eastern side of Dubuque Avenue. Sidewalks would be provided along project roadway edges. Bicycle access would be from Dubuque Avenue to either access road. Four levels of below grade parking would provide approximately 1,335 parking spaces, resulting in a ratio of approximately 1.5 spaces per 1,000 square feet of office/R&D floor area (1,285 spaces) plus visitor spaces representing approximately 20% of event center capacity (50 spaces for approximately 450 maximum attendees). Utilities Although the project will include a stubbed connection to the natural gas main to serve potential connections to commercial kitchens, the new buildings are designed to operate with 100% electric energy. The project would redevelop a site already provided with utilities and services. Localized lines may need to be extended or relocated within the project site. (See Section 19: Utilities and Service Systems for additional discussion of utilities.) In addition to on-site improvements and connections to utility lines along Dubuque Avenue, off-site utility improvements are proposed as a part of the project as follows: x The project proposes to underground the existing above-ground electrical lines along the project site frontage on Dubuque Avenue (approximately 462 linear feet) in coordination with PG&E. x The project is also proposing upsizing of the existing 8-inch sewer main along the southeastern property line of the project to a 10-inch sewer main for approximately 1,400 linear feet along the project site and south to the existing 10-inch main that crosses the Caltrain tracks (the junction is at manhole sJ2750, near the southern edge of the 720 Dubuque Avenue parcel). The project is also proposing to rehabilitate this approximately 200 linear foot length across the Caltrain tracks (between manhole sJ2750 and Poletti Way) in place, which could include sliplining, cured in place pipe, pipe bursting, or replacement of the existing pipe with a new 10- inch sewer main. 800 Dubuque Avenue Project Initial Study/MND Page 5 Construction Project construction activities are anticipated to span approximately 4 years with an assumed start for purposes of this analysis in mid-2023 or later. 4 Demolition and site preparation would take approximately 4 months. Excavation work would run approximately the next 9 months, followed by building construction over about 26 months and finishing/paving/landscaping over about 6 months. Once leased, tenant improvements would follow to the interior of the buildings and are likely to take approximately an additional 3 months or more. The buildings are currently expected to be operational as early as mid-2027. The project would involve removal of 331,000 cubic yards of soil and excavation for subsurface parking extending to depths of up to about 50 feet below ground surface. Up to 18 months of construction dewatering would be necessary during excavation as further discussed in Section 7: Geology and Soils and Section 10: Hydrology and Water Quality. Several subsurface investigations were completed between 2015 and 2022, and concluded, most recently, that while small areas of residual soil contamination may exist across the area, the risk of significant hazardous materials requiring remediation is low or non-existent. Specifically, certain metals, volatile organic compounds (VOCs), semi-volatile organic compounds (SVOCs) and total petroleum hydrocarbons (TPH) were found sporadically across the site at levels that are not anticipated to require special disposal arrangements. Because the majority of site soils will be excavated to accommodate subterranean parking, residual soil and groundwater impacts will be removed from the site, resulting in a cumulatively cleaner site. Soil and groundwater handling are detailed in Section 9: Hazards and Hazardous Materials. 4 While this analysis was performed with an assumption of a construction start in mid-2023, if construction is initiated later, impacts would be the same or lessened (due to increasing emissions controls) from those analyzed here. Page 6 800 Dubuque Avenue Project Initial Study/MND Figure 1: Project Location Source: Hexagon, 2023, modified 800 Dubuque Avenue Project Initial Study/MNDPage 7Figure 2: Existing ConditionsSource: Project Plan Set, dated October 31, 2022 Page 8800 Dubuque Avenue Project Initial Study/MNDFigure 3: Site PlanSource: Project Plan Set, dated October 31, 2022, as modified by Hexagon 800 Dubuque Avenue Project Initial Study/MND Page 9 Figure 4: Visual Model Source: Project Plan Set, dated October 31, 2022 Page 10 800 Dubuque Avenue Project Initial Study/MND Figure 5: Building Sections Source: Project Plan Set, dated October 31, 2022 800 Dubuque Avenue Project Initial Study/MND Page 11 Figure 6: Elevations, North and East Source: Project Plan Set, dated October 31, 2022 Page 12 800 Dubuque Avenue Project Initial Study/MND Figure 7: Elevations, South and West Source: Project Plan Set, dated October 31, 2022 800 Dubuque Avenue Project Initial Study/MND Page 13 MITIGATED NEGATIVE DECLARATION PROJECT DESCRIPTION, LOCATION, AND SETTING This Mitigated Negative Declaration has been prepared for the 800 Dubuque Avenue project. See the Introduction and Project Information section of this document for details of the project. POTENTIALLY SIGNIFICANT IMPACTS REQUIRING MITIGATION The following is a list of potential project impacts and the mitigation measures recommended to reduce these impacts to a less than significant level. Refer to the Initial Study Checklist section of this document for a more detailed discussion. Potential Impact Mitigation Measures Air Quality, Construction Emissions: Construction activities can result in emissions and fugitive dust. While the project emissions would be below criteria pollutant threshold levels, the Bay Area Air Quality Management District (BAAQMD) considers dust generated by grading and construction activities to be a significant impact associated with project development if uncontrolled, and recommends implementation of construction mitigation measures to reduce construction-related emissions and dust for all projects, regardless of comparison to their construction-period thresholds. These measures were adopted as part of the ShapeSSF General Plan 2040 EIR (GP-MM-Air-1a) and would be applicable to the project. Mitigation Measure Air-2 would be implemented to reduce potential health risks from project construction emissions. General Plan Mitigation Measures GP-MM-Air-1a: Basic Construction Management Practices. [The project applicant / owner / sponsor] shall incorporate the following Basic Construction Mitigation Measures recommended by the Bay Area Air Quality Management District (BAAQMD): i) All exposed surfaces (e.g., parking areas, staging areas, soil piles, graded areas, and unpaved access roads) shall be watered two times per day. ii) All haul trucks transporting soil, sand, or other loose material off-site shall be covered. iii) All visible mud or dirt trackout onto adjacent public roads shall be removed using wet power vacuum street sweepers at least once per day. The use of dry power sweeping is prohibited. iv) All vehicle speeds on unpaved roads shall be limited to 15 mph. v) All roadways, driveways, and sidewalks to be paved shall be completed as soon as possible. Building pads shall be laid as soon as possible after grading unless seeding or soil binders are used. Page 14 800 Dubuque Avenue Project Initial Study/MND Potential Impact Mitigation Measures Mitigation Measure Air-2: Reduce Diesel Particulate Matter During Construction. The project applicant / owner / sponsor shall implement a feasible plan to reduce DPM emissions by at least 50 percent such that increased cancer risk and annual PM2.5 concentrations from construction would be reduced below TAC significance levels as follows: 1. All construction equipment larger than 25 horsepower used at the site for more than two continuous days or 20 hours total shall meet U.S. EPA Tier 4 emission standards for PM (PM10 and PM2.5), if feasible, otherwise, a. If use of Tier 4 equipment is not available, alternatively use equipment that meets U.S. EPA emission standards for Tier 3 engines and include particulate matter emissions control equivalent to CARB Level 3 verifiable diesel emission control devices that altogether achieve at least a 50 percent reduction in particulate matter exhaust in comparison to uncontrolled equipment; alternatively (or in combination). b. Use of electrical or non-diesel fueled equipment. 2. Dewatering pumps shall be powered by electricity. 3. Use of electric portable equipment following the site preparation and grading phases. 4. Alternatively, the applicant may develop another construction operations plan demonstrating that the construction equipment used on-site would achieve a reduction in construction diesel particulate matter emissions by 50 percent or greater. Elements of the plan could include a combination of some of the following measures: • Implementation of No. 1 above to use Tier 4 or alternatively fueled equipment, • Installation of electric power lines during early construction phases to avoid use of diesel generators and compressors, • Use of electrically-powered equipment, • Forklifts and aerial lifts used for exterior and interior building construction shall be electric or propane/natural gas powered, • Change in construction build-out plans to lengthen phases, and • Implementation of different building techniques that result in less diesel equipment usage. Such a construction operations plan would be subject to review by an air quality expert and approved by the City prior to construction. 800 Dubuque Avenue Project Initial Study/MND Page 15 Potential Impact Mitigation Measures Biological Impact: Trees in the vicinity of the project site could host the nests of common birds that are protected under the federal Migratory Bird Treaty Act and the California Fish and Wildlife Code, so the following mitigation would be applicable to prevent a “take” of these species under these regulations related to disturbance during nesting. Mitigation Measure Bio-1: Pre-Construction Nesting Bird Survey. Initiation of construction activities during the avian nesting season (February 15 through September 15) shall be avoided to the extent feasible. If construction initiation during the nesting season cannot be avoided, pre-construction surveys for nesting birds protected by the Migratory Bird Treaty Act of 1918 and/or Fish and Game Code of California within 100 feet of a development site in the project area shall be conducted within 14 days prior to initiation of construction activities. If active nests are found, a 100-foot buffer area shall be established around the nest in which no construction activity takes place. The buffer width may be modified upon recommendations of a qualified biologist regarding the appropriate buffer in consideration of species, stage of nesting, location of the nest, and type of construction activity based upon published protocols and/or guidelines from the U.S. Fish and Wildlife Service or California Department of Fish and Wildlife (USFWS, CDFW) or through consultation with USFWS and/or CDFW. The biologist may also determine that construction activities can be allowed within a buffer area with monitoring by the biologist to and stoppage of work in that area if adverse effects to the nests are observed. The buffer shall be maintained until after the nestlings have fledged and left the nest. These surveys would remain valid as long as construction activity is consistently occurring in a given area and would be completed again if there is a lapse in construction activities of more than 14 consecutive days during the nesting season. Cultural and Tribal Cultural Resources Impact: There are no known cultural or tribal cultural resources at the site. However, given the moderate to high potential for unrecorded archeological resources and Native American resources and proposed disturbance of native soils which also have the potential to contain paleontological resources, Mitigation Measures Cul-1 through Cul-3 would address the potential for unexpected discovery of such resources. Mitigation Measures Cul-1: Cultural Resources Worker Environmental Awareness Program (WEAP). A qualified archaeologist shall conduct a WEAP training for all construction personnel on the project site prior to construction and ground-disturbing activities. The training shall include basic information about the types of paleontological, archaeological, and/or tribal artifacts and resources that might be encountered during construction activities, and procedures to follow in the event of a discovery. This training shall be provided for any personnel with the potential to be involved in activities that could disturb native soils. Page 16 800 Dubuque Avenue Project Initial Study/MND Potential Impact Mitigation Measures Cul-2: Halt Construction Activity, Evaluate Find and Implement Mitigation. In the event that previously unidentified paleontological, archaeological, or tribal resources are uncovered during site preparation, excavation or other construction activity, the project applicant shall cease or ensure that all such activity within 25 feet of the discovery is ceased until the resources have been evaluated by a qualified professional, who shall be retained by the project applicant, and specific measures can be implemented by the project applicant to protect these resources in accordance with sections 21083.2 and 21084.1 of the California Public Resources Code. Cul-3: Halt Construction Activity, Evaluate Remains and Take Appropriate Action in Coordination with Native American Heritage Commission. In the event that human remains are uncovered during site preparation, excavation or other construction activity, the project applicant shall cease or ensure that all such activity within 25 feet of the discovery is ceased until the remains have been evaluated by the County Coroner, which evaluation shall be arranged by the project applicant, and appropriate action taken by the project applicant in accordance with section 7050.5 of the California Health and Safety Code or, if the remains are Native American, in coordination with the Native American Heritage Commission and in accordance with section 5097.98 of the California Public Resources Code. Geological Impact: The San Francisco Bay Area is a seismically active region. The project site includes undocumented fill and construction activities require substantial excavation and dewatering. To mitigate the potential for damage to structures or people, the following measure shall be implemented: Mitigation Measure Geo-1: Compliance with a design-level Geotechnical Investigation report prepared by a Registered Geotechnical Engineer and with Structural Design Plans as prepared by a Licensed Professional Engineer. Proper foundation engineering and construction shall be performed in accordance with the recommendations of a Registered Geotechnical Engineer and a Licensed Professional Engineer. The structural engineering design, with supporting Geotechnical Investigation, shall incorporate seismic parameters compliant with the California Building Code. Hazardous Site Impact: The site is impacted by elevated concentrations of volatile organic compounds, total petroleum hydrocarbons, and metals. Removal of impacted soil is proposed as part of project construction activities and would be performed under Soil Management and Health and Safety Plans. Mitigation Measure Haz-1: Implement Soil Management and Health and Safety Plans. The applicant’s construction contractor shall implement soil management and health and safety plans to facilitate compliance with applicable federal, state, and local laws and regulations, applicable to earthwork activities at 800 Dubuque Avenue Project Initial Study/MND Page 17 Potential Impact Mitigation Measures the site as a result of the reported petroleum hydrocarbons and volatile organic compound concentrations in the soil. These plans must be filed with the City before construction permits are granted and are anticipated to include the following components: 1. Soil Management Plan. Recent analytical results indicate that some site soils contain slightly elevated concentrations of SVOCs, VOCs, TPH, and certain metals. The soil management objectives for the site are to minimize exposure of potentially hazardous constituents in soil to construction workers, nearby residents and pedestrians, and future users of the site. A site-specific soil management plan will be developed based on recent comprehensive subsurface investigations covering the site soils to depths exceeding planned excavations and the underlying groundwater. The soil management plan is intended to facilitate compliance with relevant federal, state, and local laws and regulations, applicable to earthwork activities at the site as a result of the identified contamination profiles. Some of the excavated material in the upper 5 feet may need to be disposed off-site at a Class II non-hazardous regulated landfill and/or as unrestrictive waste based on disposal facility’s acceptance criteria. The contractor will establish appropriate off-site disposal locations and direct truck loading scheduling and tracking and recording of all shipments per applicable regulations and/or stockpile locations on the site to properly segregate, cover, moisture control, and profile the excavated material. Further testing may instead determine that no special soil handling is required. Unless from a documented clean source such as a quarry, soil imported onto the site will be tested in accordance with the “Clean Imported Fill Material” information advisory developed by the California DTSC in October 2001. 2. Health and Safety Plan. The potential health risk to on-site construction workers and the public will be minimized by developing and implementing a comprehensive Health and Safety Plan (HASP). The contractor will be responsible for developing and implementing the HASP. The HASP plan will describe the health and safety training requirements, specific personal hygiene, and monitoring equipment that will be used during construction to protect and verify the health and safety of the construction workers and the general public from exposure to constituents in the soil, which is anticipated to include the following: x the site will be fenced; x exposed soil at the construction site will be watered at least twice daily to prevent visible dust from migrating off-site; x stockpiles will be covered; x water will be misted or sprayed during loading of material onto trucks for off haul; x trucks transporting contaminated material will be covered with a tarpaulin or other cover; Page 18 800 Dubuque Avenue Project Initial Study/MND Potential Impact Mitigation Measures x the wheels of the trucks exiting the site will be cleaned prior to entering public streets; x public streets will be swept daily if material is visible, excavation and loading activities will be suspended if winds exceed 15 miles per hour; and the fence will be posted with requirements of the safe drinking water and toxic enforcement act (Proposition 65). 3. Health and Safety Officer. A site health and safety officer identified in the Health and Safety Plan will be on site at all times during excavation activities to ensure that all health and safety measures are maintained. The health and safety officer will have authority to direct and stop (if necessary) all construction activities in order to ensure compliance with the health and safety plan. 4. Dust Control. During all excavation activities, dust control measures will be implemented to reduce potential exposure. These measures may include moisture conditioning the soil and covering exposed soil and stockpiles with weighted down plastic sheeting to prevent exposure of the soil. Dust control measures at a minimum will include: x Covering soil stockpiles with plastic sheeting. x Watering uncovered ground surface at the site; use of water will be limited to prevent runoff. x Misting or spraying of soil during excavation and loading. x Emplacement of gravel and/or rubble plates on site access roads as feasible. x Trucks hauling soil from the site will be covered. x Visible dust will be monitored during excavation and subsurface demolition. x The soil drop height from an excavator’s bucket onto soil piles or into transport trucks will be minimized. x Windbreaks will be deployed as necessary. x If necessary, the area of excavation may be limited to reduce dust generation. x Site vehicle speed limits. x Street sweeping. x Termination of excavation if winds exceed 25 mph. x Addition of soil stabilizers and other responses as needed. 5. Odor Control. If strong odors are noted during excavation activities, odor suppression measures will be implemented by the General Contractor to minimize odor during excavation activities. 6. Storm Water Pollution Controls. Storm water pollution controls will be implemented to minimize storm water runoff and sediment transport from the site. A Storm Water Pollution Prevention Plan (SWPPP) will 800 Dubuque Avenue Project Initial Study/MND Page 19 Potential Impact Mitigation Measures identify Best Management Practices for activities as specified by the California Storm Water Best Management Practices Handbook (Stormwater Quality Task Force, 1993) and/or the Manual of Standards for Erosion and Sediment Control Measures (ABAG, 1995). The SWPPP will include protocols (i.e., earth dikes and drainage swales) to control storm water contact with, or runoff from, potentially impacted soil during wet weather conditions. 7. Groundwater Management. Groundwater at the site has been encountered at depths of nine feet to fifteen feet below ground surface. Construction dewatering is anticipated based on development plans. Any construction dewatering must adhere to a discharge permit obtained from the South San Francisco Department of Public Works Water Quality Control Division, Environmental Compliance Program or the Regional Water Quality Control Board. Based on the analytical results, the groundwater may need to be treated prior to discharge. Any proposed groundwater treatment prior to discharge will require analytical testing and approval from the appropriate regulatory agency prior to discharging. 8. Contingency Plans for Unknown/Unexpected Conditions. The following tasks shall be implemented during excavation activities if unknown historical subsurface features and/or unanticipated hazardous materials are encountered. Such materials may include unaccounted for underground storage tanks (UST) and associated product lines, sumps, and/or vaults, former monitoring wells, and/or soil with significant petroleum hydrocarbon odors and/or stains. x Stop work in the area where the suspect material is encountered and cover with plastic sheets. x Notify the General Contractor’s site safety officer and site superintendent. x Review the existing health and safety plan for revisions, if necessary, and have appropriately trained personnel on-site to work with the affected materials, once directed by the General Contractor. 9. Soil and Groundwater Management Completion Report. A Soil and Groundwater Management Completion Report (SGMCR) will be prepared that summarizes the soil and groundwater management activities and any subsequent investigative and removal activities that were completed during redevelopment. The SGMCR will present a chronology of the construction events, a summary of analytical data, a copy of all manifests from the site, and a description of all soil and groundwater management activities at the site. The report will also contain laboratory analytical results and figures, as appropriate, to provide detail regarding the amount and type of contamination encountered (if any) during various activities. The report will also summarize any residual contaminants that were left on the site after Page 20 800 Dubuque Avenue Project Initial Study/MND Potential Impact Mitigation Measures completion of redevelopment activities and document that soil handling procedures were implemented in accordance with this mitigation measure. Transportation Impact: Sight distance to the south at both project driveways on Dubuque Avenue was found to be inadequate but could be corrected with the measures identified in Mitigation Measure Trans-1. Mitigation Measure Trans-1: Demonstrate Adequate Sight Distance at Project Driveways. The applicant shall demonstrate to the satisfaction of the City that the sight distance is adequate at both project driveways, which could include but is not limited to the following measures: x Coordination with the City to decrease the speed limit on Dubuque Avenue to 25 mph. x Coordination with the City to remove all line-of-sight obstructions (vegetation, utility poles and sign boards) to create clear sight lines within the City’s right-of-way to the south of the project site. x Coordination with the adjacent property to the south (720 Dubuque Avenue/PG&E easement) to push back the existing metal fence on the southern boundary of the project site and remove vegetation to provide a clear zone to the south of the project’s southern driveway. 800 Dubuque Avenue Project Initial Study/MND Page 21 LEAD AGENCY DETERMINATION On the basis of this evaluation, it can be concluded that: The proposed project COULD NOT have a significant effect on the environment, and a NEGATIVE DECLARATION will be prepared. ց Although the proposed project could have a significant effect on the environment, there will not be a significant effect in this case because mitigation measures to reduce these impacts will be required of the project. A MITIGATED NEGATIVE DECLARATION will be prepared. The proposed project MAY have a significant effect on the environment, and an ENVIRONMENTAL IMPACT REPORT is required. The proposed project MAY have a "potentially significant impact" or "potentially significant unless mitigated" impact on the environment, but at least one effect 1) has been adequately analyzed in an earlier document pursuant to applicable legal standards, and 2) has been addressed by mitigation measures based on the earlier analysis as described on attached sheets. An ENVIRONMENTAL IMPACT REPORT is required, but it must analyze only the effects that remain to be addressed. Although the proposed project could have a significant effect on the environment, because all potentially significant effects (a) have been analyzed adequately in an earlier EIR or NEGATIVE DECLARATION pursuant to applicable standards, and (b) have been avoided or mitigated pursuant to that earlier EIR or NEGATIVE DECLARATION, including revisions or mitigation measures that are imposed upon the proposed project, nothing further is required. Page 22 800 Dubuque Avenue Project Initial Study/MND INITIAL STUDY CHECKLIST ENVIRONMENTAL FACTORS POTENTIALLY AFFECTED Environmental factors that may be affected by the project are listed alphabetically below. Factors marked with an “X” (ց) were determined to be potentially affected by the project, involving at least one impact that is a potentially significant impact as indicated by the Checklist on the following pages. Unmarked factors () were determined to not be significantly affected by the project, based on discussion provided in the Checklist, including the application of mitigation measures. Aesthetics Agricultural/Forest Resources Air Quality Biological Resources Cultural Resources Energy Geology/Soils Greenhouse Gas Emissions Hazards/Hazardous Material Hydrology/Water Quality Land Use/Planning Mineral Resources Noise Population/Housing Public Services Recreation Transportation Tribal Cultural Resources Utilities/Service Systems Wildfire Mandatory Findings of Significance There are no impacts that would remain significant with implementation of the identified mitigation measures. EVALUATION OF ENVIRONMENTAL EFFECTS The Checklist portion of the Initial Study begins below, with explanations of each CEQA issue topic. Four outcomes are possible, as explained below. 1. A “no impact” response indicates that no action that would have an adverse effect on the environment would occur due to the project. 2. A “less than significant” response indicates that while there may be potential for an environmental impact, there are standard procedures or regulations in place, or other features of the project as proposed, which would limit the extent of this impact to a level of “less than significant.” 3. Responses that indicate that the impact of the project would be “less than significant with mitigation” indicate that mitigation measures, identified in the subsequent discussion, will be required as a condition of project approval in order to effectively reduce potential project-related environmental effects to a level of “less than significant.” 4. A “potentially significant impact” response indicates that further analysis is required to determine the extent of the potential impact and identify any appropriate mitigation. If any topics are indicated with a “potentially significant impact,” these topics would need to be analyzed in an Environmental Impact Report. 800 Dubuque Avenue Project Initial Study/MND Page 23 1. AESTHETICS Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Have a substantial adverse effect on a scenic vista? ց b) Substantially damage scenic resources, including, but not limited to, trees, rock outcroppings, and historic buildings within a state scenic highway? ց c) Substantially degrade the existing visual character or quality of public views of the site and its surroundings? (Public views are those that are experienced from publicly accessible vantage points.) If the project is in an urbanized area, would the project conflict with applicable zoning and other regulations governing scenic quality? ց d) Create a new source of substantial light or glare which would adversely affect day or nighttime views in the area? ց Under CEQA Section 21099(d), “Aesthetic… impacts of a residential, mixed-use residential, or employment center project on an infill site located within a transit priority area shall not be considered significant impacts on the environment.” Accordingly, aesthetics is no longer considered in determining if a project has the potential to result in significant environmental effects for projects that meet all three of the following criteria: 1. The project is in a transit priority area. CEQA Section 21099(a)(7) defines a “transit priority area” as an area within one-half mile of an existing or planned major transit stop. A “major transit stop” is defined in CEQA Section 21064.3 as a rail transit station, a ferry terminal served by either a bus or rail transit service, or the intersection of two or more major bus routes with a frequency of service interval of 15 minutes or less during the a.m. and p.m. peak commute periods. 2. The project is on an infill site. CEQA Section 21099(a)(4) defines an “infill site” as either (1) a lot within an urban area that was previously developed; or (2) a vacant site where at least 75 percent of the site perimeter adjoins (or is separated by only an improved public right-of-way from) parcels that are developed with qualified urban uses. 3. The project is residential, mixed-use residential, or an employment center. CEQA Section 21099(a)(1) defines an “employment center” as a project situated on property zoned for commercial uses with a floor area ratio of no less than 0.75 and located within a transit priority area. Page 24 800 Dubuque Avenue Project Initial Study/MND The proposed project meets all three of the above criteria because the project (1) is in a transit priority area due to its location less than 0.5 miles from the South San Francisco Caltrain (rail) Station;1 (2) is on an infill site that has been previously developed and is fully adjoined by urban uses and public rights-of-way within South San Francisco; and (3) is an employment center with a projected FAR of approximately 3.33. Thus, this section does not consider aesthetics, including the aesthetic impacts of light and glare, in determining the significance of project impacts under CEQA. Nevertheless, the City recognizes that the public and decision makers may be interested in information about the aesthetic effects of a proposed project; therefore, the information contained in this section related to aesthetics, light, and glare is provided solely for informational purposes and is not used to determine the significance of environmental impacts pursuant to CEQA. a) Scenic Vistas The project vicinity is predominantly developed with business park and industrial uses and is not considered a scenic resource or vista in any vicinity plans. Policy LU-8.1 of the ShapeSSF General Plan 2040 aims to “maintain and protect unique public views of the city, the bay, and local landmarks from major thoroughfares and hillside open spaces.”2 CEQA generally protects against significant adverse impacts to public views of scenic vistas, taking into consideration whether the view is from a location at which people gather specifically to enjoy views and the environmental context (i.e., if the area is a natural area or a developed urban area). While views of the Bay and San Bruno Mountain are considered scenic vistas for purposes of this analysis, there are no designated public viewing locations in the vicinity of the project. Views from public roadways are discussed below to indicate the potential for changed views from public locations. Views toward the Bay (to the east of the project site) and San Bruno Mountain (to the northwest of the project site) from area roadways that would cross the site are already substantially blocked at road level by existing area development, topography, and landscaping. While areas of the adjacent development could experience some blockage of views of the Bay or San Bruno Mountain, these are not public viewing locations where people gather specifically to enjoy views and obstruction of private views is therefore not considered a significant environmental impact under CEQA. As noted above, this topic is being discussed as an informational item only because the CEQA Guidelines have determined this type of project would not have a significant impact in this regard. This informational discussion agrees with the statutory conclusion that the project impact would not be significant. b) Scenic Highways U.S. 101 is not a designated or eligible State Scenic Highway corridor in the vicinity of the project nor are there any scenic corridors identified in the area.3 The project would not be visible from a 1 Metropolitan Transportation Commission, 2021, Transit Priority Area, accessed at: https://www.arcgis.com/home/item.html?id=370de9dc4d65402d992a769bf6ac8ef5 2 City of South San Francisco, ShapeSSF General Plan 2040. February 2022, page 76. 3 California Department of Transportation, State Scenic Highway Mapping System, available at: 800 Dubuque Avenue Project Initial Study/MND Page 25 designated or eligible State Scenic Highway. As noted above, this topic is being discussed as an informational item only because this type of project would not have a significant impact pursuant to the CEQA Guidelines. This informational discussion is consistent with the statutory conclusion that the project’s impact would not be significant. c) Visual Character As a project located in an urbanized area, the applicable criteria would have been whether the project would conflict with applicable zoning and other regulations governing scenic quality. The project is consistent with the zoning updates consistent with the ShapeSSF General Plan 2040. The project is generally consistent with the visual character of other office/R&D development in the vicinity. Other than those discussed elsewhere in this section, there are no other policies or regulations specific to scenic character that would be applicable to the project site. As noted above, this topic is being discussed as an informational item only because this type of project would not have a significant impact pursuant to the CEQA Guidelines. This informational discussion is consistent with the statutory conclusion that the project’s impact would not be significant. Additionally, the City would review the proposed design as part of the approval process, which can include considerations beyond those strictly environmental-focused. d) Light and Glare Sources of light and glare in the project vicinity include interior and exterior building lights, service areas and surface parking lots, pedestrian lighting, and city streetlights. Light and glare associated with vehicular traffic along major thoroughfares in the area also create sources of light and glare. The existing level and sources of light and glare are typical of those in a developed urban commercial/industrial setting. Residential uses and natural areas are particularly sensitive to light and glare impacts. The project is located in a commercial and industrial area with no immediately adjacent residential uses or natural areas and has lighting consistent with that existing in the area. As a standard condition of project approval, new lighting would be required to conform to the City’s standards that limit the amount of light that can spill over to other properties through the use of downcast lighting fixtures. The project would result in development and lighting treatments typical of the existing commercial and industrial urban settings and consistent with lighting standards to minimize lighting on adjacent areas and would therefore not result in new sources of substantial adverse light or glare. As noted above, this topic is being discussed as an informational item only because this type of project would not have a significant impact pursuant to the CEQA Guidelines. This informational discussion is consistent with the statutory conclusion that the project’s impact would not be significant. https://dot.ca.gov/programs/design/lap-landscape-architecture-and-community-livability/lap-liv-i-scenic-highways Page 26 800 Dubuque Avenue Project Initial Study/MND 2. AGRICULTURE AND FORESTRY RESOURCES In determining whether impacts to agricultural resources are significant environmental effects, lead agencies may refer to the California Agricultural Land Evaluation and Site Assessment Model (1997) prepared by the California Dept. of Conservation as an optional model to use in assessing impacts on agriculture and farmland. In determining whether impacts to forest resources, including timberland, are significant environmental effects, lead agencies may refer to information compiled by the California Department of Forestry and Fire Protection regarding the state’s inventory of forest land, including the Forest and Range Assessment Project and the Forest Legacy Assessment project; and forest carbon measurement methodology provided in Forest Protocols adopted by the California Air Resources Board. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Convert Prime Farmland, Unique Farmland, or Farmland of Statewide Importance (Farmland), as shown on the maps prepared pursuant to the Farmland Mapping and Monitoring Program of the California Resources Agency, to non-agricultural use? ց b) Conflict with existing zoning for agricultural use, or a Williamson Act contract? ց c) Conflict with existing zoning for, or cause rezoning of, forest land (as defined in Public Resources Code section 12220(g)), timberland (as defined by Public Resources Code section 4526), or timberland zoned Timberland Production (as defined by Government Code section 51104(g))? ց d) Result in the loss of forest land or conversion of forest land to non-forest use? ց e) Involve other changes in the existing environment which, due to their location or nature, could result in conversion of Farmland, to non-agricultural use or conversion of forest land to non-forest use? ց a-e) Agriculture and Forestry Resources The project site is located in a developed urban area adjacent to a highway. No part of the site is zoned for, mapped as, or currently being used for agricultural or forestry purposes or is subject to the Williamson Act. There would be no impact to agricultural and forestry resources as a result of this project. 800 Dubuque Avenue Project Initial Study/MND Page 27 3. AIR QUALITY Where available, the significance criteria established by the applicable air quality management or air pollution control district may be relied upon to make the following determinations. Would the project: Potentially Significant Impact Less Than Significant with MitigationLess Than Significant Impact No Impact a) Conflict with or obstruct implementation of the applicable air quality plan? ց b) Result in a cumulatively considerable net increase of any criteria pollutant for which the project region is non-attainment under an applicable federal or state ambient air quality standard? ց c) Expose sensitive receptors to substantial pollutant concentrations? ց d) Result in other emissions (such as those leading to odors) adversely affecting a substantial number of people? ց This section utilizes information from the Construction Air Quality & Greenhouse Gas Assessment prepared for this analysis by Illingworth & Rodkin, Inc. and dated February 17, 2023, included in full as Attachment A. a) Air Quality Plan Projects within South San Francisco are subject to the Bay Area Clean Air Plan, first adopted by the Bay Area Air Quality Management District (BAAQMD) (in association with the Metropolitan Transportation Commission and the Association of Bay Area Governments) in 1991 to meet state requirements and those of the Federal Clean Air Act. The plan is meant to demonstrate progress toward meeting the ozone standards, but also includes other elements related to particulate matter, toxic air contaminants, and greenhouse gases. The latest update to the plan, adopted in April 2017, is the Bay Area 2017 Clean Air Plan. BAAQMD recommends analyzing a project’s consistency with current air quality plan primary goals and control measures. The impact would be presumed significant if the project would conflict with or obstruct attainment of the primary goals or implementation of the control measures. The primary goals of the Bay Area 2017 Clean Air Plan are: • Attain all state and national air quality standards • Eliminate disparities among Bay Area communities in cancer health risk from toxic air contaminants • Reduce Bay Area GHG emissions 40 percent below 1990 levels by 2030, and 80 percent below 1990 levels by 2050 (This standard is addressed in Section 8: Greenhouse Gas Emissions.) Page 28 800 Dubuque Avenue Project Initial Study/MND The project would be required to comply with all applicable rules and regulations related to emissions and health risk and would not result in a new substantial source of emissions or toxic air contaminants (see items b-d below) or otherwise conflict with the primary goals of the 2017 Clean Air Plan. Many of the Clean Air Plan’s control measures are targeted to area-wide improvements, large stationary source reductions, or large employers and these are not applicable to the proposed project. However, the project would be consistent with all rules and regulations related to construction activities and the proposed development would meet current standards of energy and water efficiency (Energy Control Measure EN1 and Water Control Measure WR2) and recycling and green waste requirements (Waste Management Control Measures WA3 and WA4) and does not conflict with applicable control measures aimed at improving access/connectivity for bicycles and pedestrians (Transportation Control Measure TR9) or any other control measures. The EIR for the ShapeSSF General Plan 2040 evaluated consistency with the Clean Air Plan and identified a significant and unavoidable impact from buildout under the General Plan due to the increase in VMT compared to population increase. Three mitigation measures were included in the EIR to ensure individual projects could potentially be developed under the General Plan with less than significant impacts. This project would implement relevant General Plan EIR mitigation measures (indicated as “GP-MM”) requiring basic construction management practices to reduce construction dust and emissions (GP-MM-AIR-1a, discussed under item b and included in full, below), diesel emissions reduction during construction (GP-MM-AIR-1b, implemented through analysis by Illingworth and Rodkin and Mitigation Measure Air-2, discussed under item c below), and comply with the City’s TDM Ordinance (see Section 17: Transportation). General Plan Mitigation Measures GP-MM-Air-1a and Mitigation Measure Air-2 requiring compliance with basic construction management practices to reduce construction dust and emissions, and a plan to reduce particulate matter by at least 50 percent during construction, would also reduce the potential impact related to conflict with the Clean Air Plan. The project, therefore, would be consistent with the Clean Air Plan and have a less than significant with mitigation impact in this regard. b) Air Quality Standards/Criteria Pollutants Ambient air quality standards have been established by state and federal environmental agencies for specific air pollutants most pervasive in urban environments. These pollutants are referred to as criteria air pollutants because the standards established for them were developed to meet specific health and welfare criteria set forth in the enabling legislation and include ozone precursors including nitrogen oxides and reactive organic gasses (NOx and ROG), carbon monoxide (CO), and suspended particulate matter (PM10 and PM2.5). The Bay Area is considered “attainment” for all of the national standards, with the exception of ozone. It is considered “nonattainment” for State standards for ozone and particulate matter. Past, present, and future development projects contribute to the region’s adverse air quality impacts on a cumulative basis. By its very nature, air pollution is largely a cumulative impact. No 800 Dubuque Avenue Project Initial Study/MND Page 29 single project is sufficient in size to, by itself, result in nonattainment of ambient air quality standards. Instead, a project’s individual emissions contribute to existing cumulatively significant adverse air quality impacts.4 BAAQMD updated its Guidelines for air quality analysis in coordination with adoption of new recommended CEQA thresholds of significance on June 2, 2010.5 The most recent version of the Guidelines is dated May 2017. Project-related air quality impacts fall into two categories: short-term impacts that would occur during construction of the project and long-term impacts due to project operation. BAAQMD’s adopted thresholds are average daily emissions during construction or operation of 54 pounds per day or operational emissions of 10 tons per year of NOx, ROG or PM2.5 and 82 pounds per day or 15 tons per year of PM10. Construction and operational emissions for the project were modeled using the California Emissions Estimator Model (“CalEEMod”) version 2020.4.0. Project details were entered into the model including the proposed land uses, Transportation Demand Management Plan trip reductions, Peninsula Clean Energy carbon intensity factors, demolition/earthwork volumes, and construction schedule. Model defaults were otherwise used. The CARB EMission FACtors 2021 (EMFAC2021) model was used to predict emissions from construction traffic, which includes worker travel, vendor trucks, and haul trucks. The CalEEMod results and EMFAC inputs are included in Attachment A. Construction Emissions Construction of the project would involve excavation, site preparation, building erection, paving, and finishing and landscaping. Although these construction activities would be temporary, they would have the potential to cause both nuisance and health-related air quality impacts. BAAQMD’s adopted thresholds are average daily emissions during construction of 54 pounds per day of NOx, ROG or PM2.5 and 82 pounds per day of PM10. The results from emissions modeling for construction are summarized in Table 1 (and included in full in Attachment A). Table 1: Daily Regional Air Pollutant Emissions for Construction (Pounds per Day) Description ROG NOx PM10* PM2.5 * Maximum Average Daily Emissions 13.16 32.74 1.48 0.95 BAAQMD Daily Thresholds 54 54 82 54 Exceeds Threshold? No No No No * Applies to exhaust emissions only Source: Illingworth & Rodkin 2023, Table 4 in Attachment A. 4 BAAQMD, May 2017, California Environmental Quality Act Air Quality Guidelines, p. 2-1. 5 Bay Area Air Quality Management District. June 2, 2010. News Release http://www.baaqmd.gov/~/media/Files/Communications%20and%20Outreach/Publications/News%20Releases/2010/ceqa _100602.ashx . Page 30 800 Dubuque Avenue Project Initial Study/MND Construction-period emissions levels are below BAAQMD thresholds presented in Table 1. However, BAAQMD considers dust generated by grading and construction activities to be a significant impact associated with project development if uncontrolled and recommends implementation of construction mitigation measures to reduce construction-related emissions and dust for all projects, regardless of comparison to their construction-period thresholds. These basic measures are included in ShapeSSF General Plan 2040 Mitigation Measure GP-MM-Air-1a, which would implement BAAQMD-recommended best management practices to further reduce construction-period criteria pollutant impacts. General Plan Mitigation Measure GP-MM-Air-1a: Basic Construction Management Practices. [The project applicant / owner / sponsor] shall incorporate the following Basic Construction Mitigation Measures recommended by the Bay Area Air Quality Management District (BAAQMD): i) All exposed surfaces (e.g., parking areas, staging areas, soil piles, graded areas, and unpaved access roads) shall be watered two times per day. ii) All haul trucks transporting soil, sand, or other loose material off-site shall be covered. iii) All visible mud or dirt trackout onto adjacent public roads shall be removed using wet power vacuum street sweepers at least once per day, unless the City The use of dry power sweeping is prohibited. iv) All vehicle speeds on unpaved roads shall be limited to 15 mph. v) All roadways, driveways, and sidewalks to be paved shall be completed as soon as possible. Building pads shall be laid as soon as possible after grading unless seeding or soil binders are used. With implementation of General Plan Mitigation Measure GP-MM-Air-1a, the impact related to construction-period criteria pollutant impacts would be less than significant with mitigation. Because construction-period emissions would not exceed applicable significance thresholds, additional construction mitigation measures would not be required to mitigate impacts. Operational Emissions Emissions from operation of the project could cumulatively contribute to air pollutant levels in the region. These air pollutants include ROG and NOx that affect ozone levels (and to some degree, particulate levels), PM10 and PM2.5. Emissions of air pollutants associated with the project were predicted using CalEEMod. This model predicts daily emissions associated with development projects by combining predicted daily traffic activity, including reductions for existing uses and the required Transportation Demand Management (TDM) plan (see Section 17, Transportation, and Attachment D), associated with the different land use types, with emission factors from the State’s mobile emission factor model (i.e., EMFAC2021). Emissions associated with vehicle travel depend on the year of analysis because emission control technology requirements are phased-in over time. Therefore, the earlier the year analyzed in the model, the higher the emission rates utilized by CalEEMod. The earliest full year of operation could be 2028 if construction begins in 2023. Other inputs considered for operational emissions include the project’s two emergency diesel generators, six cooling towers, solid waste generation use and water/wastewater use. BAAQMD’s adopted thresholds are emissions during operations of 54 pounds per day or 10 tons per year of NOx, ROG or PM2.5 and 82 pounds per day or 15 tons per year of PM10. 800 Dubuque Avenue Project Initial Study/MND Page 31 Results of operational emissions modeling are included in full in Attachment A and summarized in Table 2, below. As shown in Table 2 below, the project’s operational emissions would not exceed applicable thresholds and the project would not result in individually or cumulatively significant impacts from operational criteria pollutant emissions. Table 2: Regional Air Pollutant Emissions for Operations (Tons per Year for Annual) Description ROG NOx PM10 PM2.5 2028 Project Emissions, Annual 6.37 2.47 4.26 1.14 Project Generator Emissions 0.61 0.43 0.02 0.02 Project Cooling Tower Emissions -- -- <0.01 <0.01 2022 Existing Use Emissions 0.95 0.47 0.61 0.16 Net Total Operational Emissions 6.04 2.43 3.67 0.99 BAAQMD Annual Significance Thresholds 10 10 15 10 Exceeds Annual Threshold? No No No No Project Emissions, Daily (lbs/day) 2.34 1.60 1.42 0.40 BAAQMD Daily Significance Thresholds (lbs/day) 54 54 82 54 Exceeds Daily Threshold? No No No No Source: Illingworth & Rodkin 2023, Table 5 in Attachment A. As vehicular emissions have improved over the years, carbon monoxide hotspots have become less of a concern. BAAQMD presents traffic-based criteria as screening criteria for carbon monoxide impacts, as follows.6 The project would implement a Transportation Demand Management Program per South San Francisco Municipal Code to reduce project trips. The project is therefore consistent with the Congestion Management Plan (CMP) of the San Mateo City/County Association of Governments (C/CAG), which is the first threshold. The other two screening thresholds are whether the project would increase traffic volumes at affected intersections to more than 44,000 vehicles per hour or to more than 24,000 vehicles per hour where vertical and/or horizontal mixing is substantially limited (such as a tunnel or underground parking garage). These hourly traffic volumes are very high and much higher than those in the vicinity. For example, Grand Avenue is one of the highest volume roadways in the vicinity, which carries less than 35,000 vehicles per day under existing conditions. Spread over a day, that would be substantially less than 44,000 vehicles per 6 Bay Area Air Quality Management District. May 2017. California Environmental Quality Act Air Quality Guidelines, p. 3-2, 3-3. Page 32 800 Dubuque Avenue Project Initial Study/MND hour. The project’s underground parking garage would serve only project vehicles with expected parking for 1,335 vehicles, which is again substantially fewer than the threshold of 24,000 vehicles per hour. Therefore, conditions in and around the project would be well below screening levels and the project would not result in individually or cumulatively significant impacts from CO emissions. The project is below significance thresholds established by BAAQMD and meets localized CO screening criteria. As a result, the project would have a less than significant impact on regional air quality during the operational period. c) Sensitive Receptors A toxic air contaminant (TAC) is defined by California law as an air pollutant that may cause or contribute to an increase in mortality or an increase in serious illness, or which may pose a present or potential hazard to human health. In the Bay Area, a number of urban or industrialized communities exist where the exposure to TACs is relatively high compared to other communities. According to the BAAQMD CEQA Guidelines, the project site is in an overburdened community.7 An overburdened community is a location that is especially vulnerable to air pollution impacts due to high background levels of air pollution or other environmental pollution burdens, presence of sensitive populations, and socioeconomic factors that may lead to inadequate health care or other health stressors.8,9 BAAQMD sets more stringent health risk limits and public noticing requirements for projects located in overburdened communities. Substantial sources of TACs include, but are not limited to, land uses such as highways and high- volume roadways, truck distribution centers, ports, rail yards, refineries, chrome plating facilities, dry cleaners using perchloroethylene, and gasoline dispensing facilities. The project would not involve any of these uses. However, construction activity that uses traditional diesel-powered equipment results in the emission of diesel particulate matter including fine particulate matter, which is considered a toxic air contaminant and potential health risk. Certain population groups, such as children, the elderly, and people with health problems, can be particularly sensitive to air pollution. With respect to air pollutants, examples of sensitive receptors include health care facilities, retirement homes, school and playground facilities, and residential areas. The project itself is not considered a sensitive receptor. The closest sensitive receptors to the project site are the multi-family residences approximately 350 feet to the west on the other side of U.S. 101, as well as the Gateway Child Development Center YMCA, approximately 750 feet southeast of the project site. These sensitive receptors are within 1,000 feet from the proposed project, which is the screening distance recommended by BAAQMD. A community health risk assessment was performed as included in full in Attachment A and summarized below. For the purpose of assessing a proposed project’s impacts on exposure of sensitive receptors to risks and hazards, BAAQMD’s adopted thresholds for a project in an “overburdened community” are a project-specific cancer risk exceeding 6 in one million, a non-cancer risk exceeding a Hazard Index of 7 Bay Area Air Quality Management District. May 2017. California Environmental Quality Act Air Quality Guidelines, Figure 5-1. 8 Bay Area Air Quality Management District. December 2021. Frequently Asked Questions for 2022 Permit Reform and Implementation of Regulation 2-1 and 2-5 Amendments. 9 Bay Area Air Quality Management District. December 15, 2021. Regulation 2 Permits Rule 1 General Requirements, Regulation 2-1-243 800 Dubuque Avenue Project Initial Study/MND Page 33 1.0 (or exceeding a cumulative risk of 100 in one million or a Hazard Index of 10.0 respectively), and/or an annual average PM2.5 concentration exceeding 0.3 ђg/m3 (or 0.8 ђg/m3 cumulatively). Construction activity that uses traditional diesel-powered equipment results in the emission of diesel particulate matter including fine particulate matter, which is considered a toxic air contaminant and potential health risk. The generation of these emissions would be temporary, confined to the construction-period. Operational emissions from the proposed emergency generator would also contribute to community risk. Community risks assessments from project construction and operations were performed using the recommended EPA dispersion model AERMOD to determine the potential health risks related to diesel exhaust from construction equipment and the routine testing of the diesel generator, as summarized in Table 3. Table 3: Construction and Operation Risk (Maximally Exposed Individual Sensitive Receptor) Source Cancer Risk (per million) Annual PM25 ;ʅŐͬŵϯͿ Hazard Index Project Construction (Years 0-4) Unmitigated Mitigated 11.03 2.12 0.05 0.02 <0.01 <0.01 Project Generator (Years 4-30) 0.14 <0.01 <0.01 Project Cooling Towers (Years 4-30) - <0.01 - Project Operational Trips (Years 4-30) 0.05 <0.01 <0.01 Total/Maximum Project Impacts (Years 0-30) Unmitigated Mitigated 11.46 2.15 0.05 0.02 <0.01 <0.01 BAAQMD Single-Source Threshold 6.01 0.3 1.0 Exceed Threshold? Unmitigated Mitigated Yes No No No No No 1Project site and receptors are in an overburdened community as defined by BAAQMD. Notes: Risks in this table are reported for the maximally exposed individual, factoring in age-sensitivity, and represent increased lifetime risks. Risk to all area sensitive receptors would be the same or less than that shown in this table. See Attachment A for additional detail. Source: Illingworth & Rodkin, 2023, Table 6 in Attachment A As shown in Table 3, project-specific construction-period risk would be above applicable BAAQMD thresholds without mitigation. ShapeSSF General Plan 2040 Mitigation Measure GP-MM-Air-1b requires a project-specific health risk assessment when sensitive receptors may be impacted and implementation of applicable risk reduction measures, a condition that is satisfied by the Construction Air Quality & Greenhouse Gas Assessment included as Attachment A and implementation of the identified Mitigation Measure Air-2, which sets requirements to reduce diesel particulate matter (DPM) emissions by at least 50 percent. Page 34 800 Dubuque Avenue Project Initial Study/MND Mitigation Measure Air-2: Reduce Diesel Particulate Matter During Construction. The project applicant / owner / sponsor shall implement a feasible plan to reduce DPM emissions by at least 50 percent such that increased cancer risk and annual PM2.5 concentrations from construction would be reduced below TAC significance levels as follows: 1. All construction equipment larger than 25 horsepower used at the site for more than two continuous days or 20 hours total shall meet U.S. EPA Tier 4 emission standards for PM (PM10 and PM2.5), if feasible, otherwise, a. If use of Tier 4 equipment is not available, alternatively use equipment that meets U.S. EPA emission standards for Tier 3 engines and include particulate matter emissions control equivalent to CARB Level 3 verifiable diesel emission control devices that altogether achieve at least a 50 percent reduction in particulate matter exhaust in comparison to uncontrolled equipment; alternatively (or in combination). b. Use of electrical or non-diesel fueled equipment. 2. Dewatering pumps shall be powered by electricity. 3. Use of electric portable equipment following the site preparation and grading phases. 4. Alternatively, the applicant may develop another construction operations plan demonstrating that the construction equipment used on-site would achieve a reduction in construction diesel particulate matter emissions by 50 percent or greater. Elements of the plan could include a combination of some of the following measures: • Implementation of No. 1 above to use Tier 4 or alternatively fueled equipment, • Installation of electric power lines during early construction phases to avoid use of diesel generators and compressors, • Use of electrically-powered equipment, • Forklifts and aerial lifts used for exterior and interior building construction shall be electric or propane/natural gas powered, • Change in construction build-out plans to lengthen phases, and • Implementation of different building techniques that result in less diesel equipment usage. Such a construction operations plan would be subject to review by an air quality expert and approved by the City prior to construction. With the implementation of Mitigation Measure Air-2, the project’s construction risks would be reduced below the BAAQMD single source threshold for cancer risks. Community health risk assessments typically also look at all substantial sources of TACs that can affect sensitive receptors and are located within 1,000 feet of the project site (i.e., influence area). These sources can include railroads, freeways or highways, high-volume surface streets, and stationary sources permitted by BAAQMD. The project vicinity includes three high volume roadways with average daily traffic (ADT) above 10,000 (Highway 101, Dubuque Avenue, and Airport Boulevard), Caltrain, and stationary sources 800 Dubuque Avenue Project Initial Study/MND Page 35 such as diesel generators and gas stations. Therefore, an additional cumulative community risk analysis was completed. The cumulative cancer risk, hazard index, and annual PM2.5 concentrations are summarized in Table 4. Table 4: Cumulative Community Risk (Maximally Exposed Individual Sensitive Receptor, Mitigated) Source Cancer Risk (per million) Annual PM25 ;ʅŐͬŵϯͿ Hazard Index Total/Maximum Project Risk, Mitigated (Years 0-30) 2.15 0.02 <0.01 Additional Cumulative Sources U.S. 101, ADT 179,520 2.29 0.12 <0.01 Caltrain Zone 1 4.50 <0.01 <0.01 Airport Boulevard 0.15 0.01 <0.01 Dubuque Avenue 0.16 0.02 <0.01 Other stationary sources 15.97 0.39 <0.10 Combined Sources 25.22 <0.57 <0.15 BAAQMD Cumulative Source Threshold 100 0.8 10.0 Exceed Threshold? No No No Notes: Risks in this table are reported for the maximally exposed individual, factoring in age-sensitivity, and represent increased lifetime risks. Risk to all area sensitive receptors would be the same or less than that shown in this table. See Attachment A for additional detail. Source: Illingworth & Rodkin, 2023, Table 7 in Attachment A As shown in Table 4, cumulative health risks to off-site sensitive receptors would not exceed threshold levels. Exposure risks for the maximally exposed individual are below threshold levels with implementation of Mitigation Measure Air-2; therefore, the impact related to exposure to sensitive receptors to substantial pollutant concentrations would be less than significant with mitigation. d) Other Emissions Odors from construction activities are associated with construction equipment exhaust and the application of asphalt and architectural coatings. Odors emitted from construction activities would be temporary and not likely to be noticeable much beyond a project site’s boundaries. The proposed office/R&D use is consistent with the type of development in the area and is not a use type considered by BAAQMD to be a source of substantial objectionable odors.10 Therefore, the potential for objectionable odor impacts to adversely affect a substantial number of people is less than significant. 10 Bay Area Air Quality Management District. May 2017. California Environmental Quality Act Air Quality Guidelines, Table 3-3. Page 36 800 Dubuque Avenue Project Initial Study/MND 4. BIOLOGICAL RESOURCES Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Have a substantial adverse effect, either directly or through habitat modifications, on any species identified as a candidate, sensitive, or special status species in local or regional plans, policies, or regulations, or by the California Department of Fish and Game or U.S. Fish and Wildlife Service? ց b) Have a substantial adverse effect on any riparian habitat or other sensitive natural community identified in local or regional plans, policies, or regulations, or by the California Department of Fish and Game or US Fish and Wildlife Service? ց c) Have a substantial adverse effect on state or federally protected wetlands (including, but not limited to, marsh, vernal pool, coastal, etc.) through direct removal, filling, hydrological interruption, or other means? ց d) Interfere substantially with the movement of any native resident or migratory fish or wildlife species or with established native resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites? ց e) Conflict with any local policies or ordinances protecting biological resources, such as a tree preservation policy or ordinance? ց f) Conflict with the provisions of an adopted Habitat Conservation Plan, Natural Community Conservation Plan, or other approved local, regional, or state habitat conservation plan? ց a) Special Status Species and Habitat The project site consists entirely of developed land and has been under industrial or commercial usage since the 1920s. It is situated within a heavily urbanized area and is surrounded on all sides by commercial or transportation uses. The site has little or no habitat value. There is a line of trees along the eastern property line between the project site and Caltrain right-of-way, trees between the project site and both adjacent lots, and trees in the central parking lot. Special-status species are unlikely to occur in the project vicinity due to its highly disturbed and urbanized nature. Plant and animal species that may occur in such areas would be common species associated with urban, developed, and ruderal conditions throughout the San Francisco Bay area. 800 Dubuque Avenue Project Initial Study/MND Page 37 The site does not contain protected habitat, is not in an ecologically sensitive area, and does not provide connections for wildlife.11 Special-status and non-status nesting birds have the potential to nest in trees, shrubs, herbaceous vegetation, and on bare ground and man-made structures within and adjacent to the project site. The federal Migratory Bird Treaty Act and Fish and Game Code of California protect bird species year-round, as well as their eggs and nests during the nesting season. The list of migratory birds includes almost every native bird in the United States. Project construction activities have the potential to impact nests on site or in nearby areas if construction is initiated during the breeding bird season. Indirect visual and acoustic disturbance from construction to off-site nesting birds in adjacent areas has the potential to result in nest abandonment, which is considered a potentially significant impact. Mitigation Measure Bio-1: Pre-Construction Nesting Bird Survey . Initiation of construction activities during the avian nesting season (February 15 through September 15) shall be avoided to the extent feasible. If construction initiation during the nesting season cannot be avoided, pre-construction surveys for nesting birds protected by the Migratory Bird Treaty Act of 1918 and/or Fish and Game Code of California within 100 feet of a development site in the project area shall be conducted within 14 days prior to initiation of construction activities. If active nests are found, a 100-foot buffer area shall be established around the nest in which no construction activity takes place. The buffer width may be modified upon recommendations of a qualified biologist regarding the appropriate buffer in consideration of species, stage of nesting, location of the nest, and type of construction activity based upon published protocols and/or guidelines from the U.S. Fish and Wildlife Service or California Department of Fish and Wildlife (USFWS, CDFW) or through consultation with USFWS and/or CDFW. The biologist may also determine that construction activities can be allowed within a buffer area with monitoring by the biologist to and stoppage of work in that area if adverse effects to the nests are observed. The buffer shall be maintained until after the nestlings have fledged and left the nest. These surveys would remain valid as long as construction activity is consistently occurring in a given area and would be completed again if there is a lapse in construction activities of more than 14 consecutive days during the nesting season. With implementation of Mitigation Measure Bio-1, which requires avoidance of nesting season or a nesting survey and buffers from any nests as appropriate, the impact related to special-status and non-status bird species would be less than significant with mitigation. 11 City of South San Francisco, ShapeSSF General Plan 2040. February 2022, Figures 48, 49, and 50. Page 38 800 Dubuque Avenue Project Initial Study/MND b, c) Riparian Habitat and Wetlands No wetlands, riparian habitats, or other sensitive habitats are present at the site.12, 13 Therefore, the project would have no impact with respect to riparian habitats and wetlands. d) Wildlife Corridors or Nursery Sites The project site is surrounded by roadways and other developed areas and does not connect undeveloped areas or otherwise have the potential to act as a substantial wildlife corridor or nursery site. Therefore, the project would have no impact with respect to wildlife nursery sites or movement. e) Local Policies and Ordinances There are approximately 118 mature trees at the existing project site. As part of the proposed development, the project proposes removal of 23 mature trees, two of which qualify as “protected” trees under the City’s Tree Preservation Ordinance (Title 13, Chapter 13.30 of the City’s Municipal Code). The applicant is required to comply with the City’s Tree Preservation Ordinance as applicable, which requires demonstrating adequate replacement and obtaining a permit for removal of “protected” trees. Approximately 150 trees would be planted with the project’s landscape plan. This is consistent with Policy LU-8.4 of the ShapeSSF General Plan 2040, which requires new developments to add street trees along streets and public places, as well as Policy ES-4.3, which requires each removed tree to be replaced with three new trees, when removal cannot be avoided.14 The project would have a less than significant impact regarding conflicts with local policies and ordinances, including tree preservation. f) Conservation Plans There are no habitat conservation plans applicable to the project site. Therefore, the project would have no impact with respect to conservation plans. 12 U.S. Fish and Wildlife Service, National Wetlands Inventory, Wetlands Mapper. Available at https://www.fws.gov/wetlands/data/mapper.html. Accessed August 2022. 13 City of South San Francisco, ShapeSSF General Plan 2040. February 2022, Figures 48, 49, and 50. 14 City of South San Francisco, ShapeSSF General Plan 2040. February, 2022. 800 Dubuque Avenue Project Initial Study/MND Page 39 5. CULTURAL RESOURCES Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Cause a substantial adverse change in the significance of a historical resource pursuant to Public Resources Section 15064.5? ց b) Cause a substantial adverse change in the significance of an archaeological resource pursuant to Public Resources Section 15064.5? ց c) Disturb any human remains, including those interred outside of formal cemeteries? ց a) Historic Resources A records search was performed by the Northwest Information Center (Attachment B), which indicated that the project site has no recorded buildings or structures listed with the historical registries consulted. The existing structures were built in 1986. There is no potential to impact historic resources, thus the project would have no impact on historic resources. b, c) Archaeological Resources and Human Remains The records search performed by the Northwest Information Center, which indicated that while there are no known cultural resources present in the project area, there is a moderately high potential for the inadvertent discovery of previously unrecorded Native American and historic- period archaeological resources based on the characteristics of the site and history of the region. A record search of the Native American Heritage Commission Sacred Lands File was completed for the project and indicated there are no known sacred lands present in the vicinity of the site (see Attachment B). See Section 18: Tribal Cultural Resources for additional discussion of this topic. Although previous studies included field survey of the project site, significant excavation and below- grade levels are proposed, which would disturb previously-undisturbed soils well below the field survey levels. Construction activities associated with the project would include excavation extending approximately 50 feet below the surface in the area of the parking garage. Given the moderately high potential for unrecorded archeological resources and Native American resources, Mitigation Measures Cul-1 through Cul-3 shall be implemented. Mitigation Measures Cul-1: Cultural Resources Worker Environmental Awareness Program (WEAP). A qualified archaeologist shall conduct a WEAP training for all construction personnel on the project site prior to construction and ground-disturbing activities. The training shall include basic information about the types of paleontological, archaeological, and/or tribal artifacts and resources that might be encountered during construction activities, and procedures to follow in the Page 40 800 Dubuque Avenue Project Initial Study/MND event of a discovery. This training shall be provided for any personnel with the potential to be involved in activities that could disturb native soils. Cul-2: Halt Construction Activity, Evaluate Find and Implement Mitigation. In the event that previously unidentified paleontological, archaeological, or tribal resources are uncovered during site preparation, excavation or other construction activity, the project applicant shall cease or ensure that all such activity within 100 feet of the discovery is ceased until the resources have been evaluated by a qualified professional, who shall be retained by the project applicant, and specific measures can be implemented by the project applicant to protect these resources in accordance with sections 21083.2 and 21084.1 of the California Public Resources Code. If protections are required, they must be approved by the Economic and Community Development Department before work can resume. Cul-3: Halt Construction Activity, Evaluate Remains and Take Appropriate Action in Coordination with Native American Heritage Commission. In the event that human remains are uncovered during site preparation, excavation or other construction activity, the project applicant shall cease or ensure that all such activity within 25 feet of the discovery is ceased until the remains have been evaluated by the County Coroner, which evaluation shall be arranged by the project applicant, and appropriate action taken by the project applicant in accordance with section 7050.5 of the California Health and Safety Code or, if the remains are Native American, in coordination with the Native American Heritage Commission and in accordance with section 5097.98 of the California Public Resources Code. These mitigation measures are consistent with and expand upon ShapeSSF General Plan 2040 Policy ES-10.5, which would require all work to cease within 100 feet if significant historic or prehistoric archaeological artifacts are discovered during construction or grading activities until the resources can be examined by a qualified archaeologist, and if necessary, protected with a plan approved by the Economic and Community Development Department. Implementation of Mitigation Measures Cul-1, Cul-2, and Cul-3 would reduce the impacts associated with possible disturbance of unidentified cultural resources at the project site to a level of less than significant with mitigation. 800 Dubuque Avenue Project Initial Study/MND Page 41 6. ENERGY Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Result in potentially significant environmental impact due to wasteful, inefficient, or unnecessary consumption of energy resources, during project construction or operation? ց b) Conflict with or obstruct a state or local plan for renewable energy or energy efficiency? ց a, b) Energy The threshold of significance related to energy use is whether the project would result in wasteful, inefficient, or unnecessary consumption of energy resources or conflict with or obstruct state or local plans for renewable energy or energy efficiency. The project would include short-term demolition and construction activities that would consume energy, primarily in the form of diesel fuel (e.g., mobile construction equipment), gasoline (e.g. vehicle trips by construction workers), and electricity (e.g., power tools). Energy would also be used for conveyance of water used in dust control, transportation and disposal of construction waste, and energy used in production and transport of construction materials. During operation, energy demand from the project would include fuel consumed by employees ’and delivery vehicles, and electricity consumed by the proposed structures, including lighting, research equipment, water conveyance, heating and air conditioning. Table 5 shows the project’s estimated total construction energy consumption and annual energy consumption. As shown in Table 5, project construction would require what equates to 123,942 MMBtu of energy use. The project would implement construction management practices per Mitigation Measure GP- MM-Air-1a (See Section 3: Air Quality). While focused on emissions and dust reduction, the construction management practices would also reduce energy consumption through anti-idling measures and proper maintenance of equipment. The project would comply with the requirements of the California Green Building Standards Code (CALGreen) to divert a minimum of 65 percent of construction and demolition debris. By reusing or recycling construction and demolition debris, energy that would be used in the extraction, processing and transportation of new resources is reduced. Therefore, the project would not involve the inefficient, wasteful, and unnecessary use of energy during construction, and the project’s construction energy consumption. As also shown in Table 5, project annual energy consumption would equate to 113,050 MMBtu of energy use. Consistent with the City’s Reach Code, the project has proposed all-electric construction. The project’s required TDM plan (see Section 17: Transportation) will also include various measures designed to reduce total vehicle trips, which would reduce the consumption of fuel for vehicles. Page 42 800 Dubuque Avenue Project Initial Study/MND Table 5: Construction and Operational Energy Usage Source Energy Consumption Amount and Units Converted to MMBtu Construction Energy Use (Total) Construction Worker Vehicle Trips (Gasoline) 155,278 gallons 17,047 MMBtu Construction Equipment and Vendor/Hauling Trips (Diesel) 778,092 gallons 106,895 MMBtu Total Construction Energy Use 123,942 MMBtu Operational Vehicle Fuel Use (Gross Annual) Gasoline 449,307 gallons 49,328 MMBtu Diesel 50,314 gallons 6,912 MMBtu Operational Built Environment (Gross Annual) Site Improvements 16.65 GWh 56,810 MMBtu Total Gross Annual Operational Energy Use 113,050 MMBtu Note: The energy use reported in this table is gross operational energy use for the proposed project with no reduction to account for energy use of existing uses. Source: Energy Calculations included as Attachment C When subtracting existing operational fuel and built environment energy use from the project totals above, the total net increase in annual operational energy use would be 99,297 MMBtu (see Attachment C for additional detail). As detailed in Section 17: Transportation, with implementation of the required TDM Plan, the project would result in reduced levels of vehicle travel relative to regional averages and would help meet regional efforts to reduce vehicle travel and therefore related vehicular consumption of fuel energy. As detailed in Section 3: Air Quality and Section 8: Greenhouse Gas Emissions, the project is also consistent with regional and local climate actions plans. The project incorporates energy and energy-related efficiency measures meeting all applicable requirements, including water and waste efficiency. The project would be required to comply with all standards of the City’s Reach Code, Title 24 of the California Code of Regulations, and CALGreen, as applicable, aimed at the incorporation of energy-conserving design and construction. The project would meet LEED Gold standards and comply with Architecture 2030’s energy target of an 80% reduction in energy use of comparable buildings in the same climate zone. Sustainability features to reduce the use of energy may include, but are not limited to, the following: 800 Dubuque Avenue Project Initial Study/MND Page 43 • Architectural fin optimization for solar shading and daylighting • High performance windows exceeding energy code thermal performance • High performance walls, roof, and floors exceeding energy code thermal performance • Tight building construction targeting 0.40 CFM/SF air infiltration at 75 Pa pressure • Heat recovery for ventilation air • Air source heat pump space heating and cooling • Low flow domestic hot water fixtures • Daylight harvesting and dimming in common spaces • High efficiency lighting • Occupancy/vacancy sensors to control lighting in back of house spaces Additionally, approximately 15% of the roof area of each building is available to support PV solar panels, which could be readily integrated to meet tenant and market demand. While representing a change from the former uses at the site, the project is consistent with the type of development in the area and allowed under the land use designation and zoning and would be replacing less efficient buildings. Therefore, although the project would incrementally increase energy consumption, it would not result in a significant impact related to energy consumption in a wasteful, inefficient, or unnecessary manner or otherwise conflict with energy plans and the impact in this regard would be less than significant. Page 44 800 Dubuque Avenue Project Initial Study/MND 7. GEOLOGY AND SOILS Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Directly or indirectly cause potential substantial adverse effects, including the risk of loss, injury, or death involving: i) Rupture of a known earthquake fault, as delineated on the most recent Alquist-Priolo Earthquake Fault Zoning Map issued by the State Geologist for the area or based on other substantial evidence of a known fault? (Refer to Division of Mines and Geology Special Publication 42) ց ii) Strong seismic ground shaking? ց iii) Seismic-related ground failure, including liquefaction? ց iv) Landslides? ց b) Result in substantial soil erosion or the loss of topsoil? ց c) Be located on a geologic unit or soil that is unstable, or that would become unstable as a result of the project, and potentially result in on- or off-site landslide, lateral spreading, subsidence, liquefaction or collapse? ց d) Be located on expansive soil, as defined in Table 18-1-B of the Uniform Building Code (1994), creating substantial direct or indirect risks to life or property? ց e) Have soils incapable of adequately supporting the use of septic tanks or alternative waste water disposal systems where sewers are not available for the disposal of waste water? ց f) Directly or indirectly destroy a unique paleontological resource or site or unique geologic feature? ց This section utilizes information from the Geotechnical Investigation prepared for the applicants by Langan Engineering and Environmental Services, dated July 9, 2021, and the Draft Dewatering Assessment also prepared by Langan and dated September 2, 2022, both of which are available as part of project materials on file with the City. a) Seismic Hazards The major active faults in the area are the San Andreas, San Gregorio, and Hayward Faults. The closest fault traces are located approximately 3.1 miles from the project site. The project site is not within an Alquist-Priolo Seismic Hazard Zone, and no known active or potentially active faults traverse the site. Therefore, the project has no impact related to rupture along a fault. 800 Dubuque Avenue Project Initial Study/MND Page 45 Similarly, the project site is generally flat and is not located proximate to steep slopes and would therefore not be subject to landslide hazards (no impact). However, the San Francisco Bay Area is a seismically active region, and the site is likely to encounter strong seismic ground shaking during the lifetime of the project, which can result in seismic-related ground failure depending on the characteristics of the site and development. The Geotechnical Investigation determined the potential geological hazards based on site soils to include the potential for seismic hazards, including liquefaction-induced settlement and seismic densification. Geotechnical considerations include the localized presence of marsh and Bay Mud deposits, the need to provide adequate bearing for the building loads, design and installation of shoring and dewatering systems to support the basement excavation and reduce the potential for impacting surrounding improvements, design and installation of micropiles, and construction considerations, as summarized below. The project site is not within a mapped liquefaction hazard zone, but the project’s Geotechnical Investigation assessed the potential for liquefaction given the characteristics of the site soils. The medium dense sand below the groundwater level is not susceptible to liquefaction and would also be removed from under the proposed building. The medium-dense granular soil present above the groundwater level presents a low risk for cyclic densification and settlement during a seismic event, although portions of the site could see settlement of about ¾ inches during a major earthquake. These would also be removed from the under the building footprint during excavation, but design of utilities and building entrances and other improvements at the building perimeter, if any, should consider this potential differential settlement between the outside ground and building. The Geotechnical Report concluded that the potential seismic hazards can be addressed through appropriate design and construction, which would occur as part of the design-level geotechnical recommendations and structural plans as specified in Mitigation Measure Geo-1. Mitigation Measure Geo-1: Compliance with a design-level Geotechnical Investigation report prepared by a Registered Geotechnical Engineer and with Structural Design Plans as prepared by a Licensed Professional Engineer. Proper foundation engineering and construction shall be performed in accordance with the recommendations of a Registered Geotechnical Engineer and a Licensed Professional Engineer. The structural engineering design, with supporting Geotechnical Investigation, shall incorporate seismic parameters compliant with the California Building Code. This mitigation measure is consistent with, and expands upon, ShapeSSF General Plan 2040 Action CR-4.4.1, which requires site-specific soils and geologic reports for review and approval by the City Engineer as part of the standard City process, and incorporation of the recommended actions during construction. Compliance with a design-level Geotechnical Investigation and Structural Design Plans, as required by Mitigation Measure Geo-1 would reduce the potential impact of seismic hazards including seismic ground shaking and liquefaction to a level of less than significant with mitigation. b) Soil Erosion Construction activities, particularly grading and site preparation, can result in erosion and loss of topsoil. The project also proposes substantial additional excavation for up to 4 floors of subsurface parking. While intentional removal of soil from the site would not be considered erosion, the disturbance of the site could result in the potential for unintended erosion. Page 46 800 Dubuque Avenue Project Initial Study/MND The project would be required to obtain coverage under the statewide National Pollutant Discharge Elimination System (NPDES) General Permit for Discharges of Storm Water Associated with Construction Activity, Construction General Permit Order 2009-0009-DWQ (Construction General Permit), administered by the State Water Resources Control Board (SWRCB). Coverage under the NPDES Permit would require implementation of a Stormwater Pollution Prevention Plan (SWPPP) and various site-specific best management practices (BMPs) to reduce erosion and loss of topsoil during site demolition and construction. Compliance with the NPDES permit and BMPs during demolition and construction such as straw wattles, silt fencing, concrete washouts, and inlet protection during construction would reduce impacts resulting from loss of topsoil. The project would be required to comply with South San Francisco Municipal Code (“SSFMC”) Section 15.56.030, which would require the development of the project site to control filling, grading, and dredging which may increase flood damage. Soil erosion after construction would be controlled by implementation of approved landscape and irrigation plans. With the implementation of a SWPPP and Erosion Control Plan to prevent erosion, sedimentation, and loss of topsoil during and following construction – which are required under existing regulations - the soil erosion impacts of the project would be less than significant. c) Unstable Soil The soils at the project site and in the surrounding areas contain 4 to 8.5 feet of fill, generally consisting of medium dense to dense sands and very stiff to hard clay. With the exception of the southwestern portion of the site, below the fill is approximately 37.5 to 48.5 feet of Colma formation, which consists of silty and clayey sand and is generally dense to very dense. In the southwestern portion of the project site, the fill is underlain by weak, compressible marsh deposits. Under those deposits is approximately 11 feet of Bay Mud, a weak and compressible marine clay. Characteristics of site soils would largely be addressed through the proposed excavation, which would remove unstable soils in the building basement footprint. The Geotechnical Investigation determined the project site to be at low risk for lateral spreading due to its flat nature, the absence of any nearby steep slopes and its low potential for liquefaction. However, the project would require substantial excavation and related dewatering activities, which could result in on- and off-site subsidence or collapse if not handled appropriately. To minimize the need for dewatering, the project is proposing shoring using deep soil mixing (DSM) walls with grouted tiebacks and/or internal bracing for additional lateral support for temporary excavation support. Because DSM walls are continuous, they act to temporarily cut off groundwater infiltration through the sides of the excavation, resulting in the need for less dewatering. Langan performed a series of groundwater drawdown simulations to address potential conditions that could be encountered during excavation and in all cases, the potential for settlement would be 1.75 inches or less at 25 feet from the excavation and declining farther from the site. The Langan report concludes that the potential geological hazards related to unstable soil, including off-site subsidence or collapse due to excavation and dewatering, can be addressed through appropriate design and construction, which would occur as part of the design-level geotechnical recommendations and structural plans as specified in Mitigation Measure Geo-1. Mitigation Measure Geo-1 requiring compliance with geotechnical investigation construction methodologies would also reduce the potential impact related to unstable soil or collapse. 800 Dubuque Avenue Project Initial Study/MND Page 47 Compliance with a design-level Geotechnical Investigation and Structural Design Plans, as required by Mitigation Measure Geo-1 would reduce the potential impact of unstable soil hazards including off-site subsidence or collapse due to excavation and dewatering to a level of less than significant with mitigation. d) Expansive Soil The Geotechnical Investigation did not identify the potential for expansive soils at the site. Therefore, the project has no impact related to expansive soils. e) Septic Tanks The project would not include the use of septic tanks and associated disposal facilities. Therefore, the project would have no impact in this regard. f) Unique Geologic Feature or Paleontological Resource The project site is a generally flat infill site and does not contain unique geologic features. The area east of Highway 101 is underlain by deposits of Bay mud, which have some sensitivity for paleontological vertebrates, though there are no known paleontological resources in the vicinity of the project site.15, 16 The project site falls within a highly urbanized area and the site is underlain by about 4 to 8.5 feet of fill; however, the excavation for the parking garage would dig to a depth of up to about 50 feet, which is likely to encounter native soils that have not been previously disturbed. Therefore, the project has a potential to encounter paleontological resources, which would be addressed through the following measures. Mitigation Measures Cul-1 and Cul-2 would reduce the potential impact related to unknown paleontological resources. Implementation of Mitigation Measures Cul-1 and Cul-2 would reduce the impacts associated with possible disturbance of previously-unidentified paleontological resources to less than significant with mitigation. 15 South San Francisco General Plan, 1999. 16 University of California Museum of Paleontology (UCMP) Online Database. 2019. UCMP specimen search portal, http://ucmpdb.berkeley.edu/ (accessed August 2022). Page 48 800 Dubuque Avenue Project Initial Study/MND 8. GREENHOUSE GAS EMISSIONS Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Generate greenhouse gas emissions, either directly or indirectly, that may have a significant impact on the environment? ց b) Conflict with an applicable plan, policy or regulation adopted for the purpose of reducing the emissions of greenhouse gases? ց This section utilizes information from the Air Quality & Greenhouse Gas Assessment prepared for this analysis by Illingworth & Rodkin, Inc. and dated February 17, 2023, included in full as Attachment A. a) Greenhouse Gas Emissions BAAQMD determined that greenhouse gas (GHG) emissions and global climate change represent cumulative impacts. Construction and operation of the proposed project would be additional sources of GHG emissions, primarily through consumption of fuel for transportation and energy usage on an ongoing basis. State Assembly Bill 32 (AB 32) required California state and local governments to reduce greenhouse gas emissions to 1990 levels by 2020. State Senate Bill 32 was subsequently adopted to require that there be a further reduction in GHG emissions to 40% below the 1990 levels by 2030. The additional 40% reduction by 2030 identified in SB 32 equates to a 2030 efficiency standard of 2.8 metric tons CO 2e per year per service population. In April 2022, BAAQMD issued new GHG emissions thresholds, revising the quantified threshold to a checklist of compliance, requiring consistency with either criterion A or B as follows: A. Projects must include, at a minimum, the following project design elements: 1. Buildings a. The project will not include natural gas appliances or natural gas plumbing (in both residential and nonresidential development). b. The project will not result in any wasteful, inefficient, or unnecessary electrical usage as determined by the analysis required under CEQA Section 21100(b)(3) and Section 15126.2(b) of the State CEQA Guidelines. 2. Transportation a. Achieve compliance with electric vehicle requirements in the most recently adopted version of CALGreen Tier 2. b. Achieve a reduction in project-generated vehicle miles traveled (VMT) below the regional average consistent with the current version of the California Climate Change Scoping Plan (currently 15 percent) or meet a locally adopted Senate Bill 743 VMT target, reflecting the recommendations provided in the Governor’s Office of Planning and Research’s Technical Advisory on Evaluating Transportation Impacts in CEQA: 800 Dubuque Avenue Project Initial Study/MND Page 49 i. Residential projects: 15 percent below the existing VMT per capita ii. Office projects: 15 percent below the existing VMT per employee iii. Retail projects: no net increase in existing VMT B. Be consistent with a local GHG reduction strategy that meets the criteria under State CEQA Guidelines Section 15183.5(b). Regarding criterion A, the proposed buildings would be constructed in conformance with CALGreen and the Title 24 Building Code, which requires high-efficiency water fixtures, water-efficient irrigation systems, and compliance with current energy efficacy standards and would meet BAAQMD’s checklist as follows: A.1.a. Avoid construction of new natural gas connections for the non-residential building, Conforms – project includes a stub natural gas connection but is designed to be operated with 100% electricity. A.1.b. Avoid wasteful or inefficient use of electricity, Conforms – would meet CALGreen Building Standards Code requirements that are considered to be energy efficient. A.2.a. Include electric vehicle charging infrastructure that meets current Building Code CALGreen Tier 2 compliance, and Conforms – 81 EV parking spaces are proposed to be constructed up front (6% of total) with an additional 268 spaces EV-ready for future operation (20% of total). This is consistent with the requirements under Section 20.330.008 of the City’s Municipal Code and the CalGreen Tier 2 requirements at the time of project application. A.2.b. Reduce VMT per service population by 15 percent over regional average. Conforms – The proposed TDM plan would reduce vehicle trips more than 15 percent over regional average (see Section 17: Transportation). As indicated above, all relevant criteria would be met and the project would therefore be considered to have a less than significant impact with respect to Greenhouse Gas Emissions. Note that it is not necessary to consider criterion B since the project meets criterion A. However, the following information is provided for informational purposes. Along with the ShapeSSF General Plan 2040, the City adopted a Climate Action Plan (CAP) in October 2022 with the goal of achieving carbon neutrality by 2045, reduce emissions 40% by 2030, and 80% by 2040. There is not currently a checklist for development projects, but the following strategies and actions are indirectly applicable to this proposed project through action and enforcement by the City: BNC 1.1 Improve the energy efficiency of new construction. Provide a combination of financial and development process incentives (e.g. Expedited permitting, FAR increase, etc.) to encourage new development to exceed Title 24 energy efficiency standard. Page 50 800 Dubuque Avenue Project Initial Study/MND Supports – The project would meet LEED Gold standards and the Architecture 2030 Energy target of an 80% reduction in energy use of comparable buildings in the same climate zone. BNC 2.1 All-Electric Reach Code for Nonresidential New Construction. Implement residential all- electric reach code and adopt all-electric reach code for nonresidential new construction. Supports – The project is designed to operate as all-electric. BE 1.3 Energy Efficiency Programs. Update zoning and building codes to require alterations or additions at least 50% the size of the original building to comply with minimum CALGreen requirements. Supports – The project would meet minimum applicable CALGreen requirements. The project would also meet LEED Gold requirements. TL 2.2 TDM Program. Implement, monitor, and enforce compliance with the City’s TDM Ordinance. Supports – The project would incorporate a TDM plan that follows the City’s TDM Ordinance. TL 2.6 Complete Streets Policy. Ensure that all roadway and development projects are designed and evaluated to meet the needs of all street users, and that development projects contribute to multimodal improvements in proportion to their potential impacts on vehicle miles traveled. Incorporate bicycle and pedestrian improvements identified in the Active South City Plan. Assumed Support – Pedestrian and bicycle circulation on Dubuque Avenue are currently under study. The project applicant would coordinate with the City to incorporate any applicable bicycle or pedestrian improvements necessary to meet this policy when finalized. WW 2.1 Indoor Water Efficiency Standards. Require high-efficiency fixtures in all new construction and major renovations, comparable to CalGreen Tier 1 or 2 standards. Supports – The project would be required to meet the CALGreen and the Title 24 Building Code, which requires high-efficiency water fixtures and water-efficient irrigation systems. To further support conclusions related to the qualitative criteria above, GHG emissions were modeled quantitatively using CalEEMod, as discussed in Section 3: Air Quality, and are included here as an informational item. To meet 2020 reduction targets, BAAQMD had recommended threshold of significance for operational GHGs of 1,100 metric tons carbon dioxide equivalent (CO 2e) per year or, if the project was too large to meet that threshold, an efficiency threshold of 4.6 metric tons CO2e per service population (residents and employees) per year. Because this is a relatively large office/R&D project, the efficiency threshold would be most applicable to this analysis. While BAAQMD did not update recommendations to address 2030 reduction targets, industry standard is to assume an additional 40% reduction per State directives, which equates to a standard of 2.8 metric tons CO2e per year per service population. A summary of the results is included in Table 6. 800 Dubuque Avenue Project Initial Study/MND Page 51 Table 6: Greenhouse Gas Emissions Description GHG in metric tons CO2e per year 1 Project Emissions, Operational 5,510 Project Emissions, Construction (averaged over 40 years) 2 168 Project Emissions, Total 5,678 Project Service Population 3 2,690 Project Emissions, Total (per Service Population) 4 2.11 Project Service Population Extrapolated Significance Threshold 2.8 in 2030 Exceeds Threshold? No Source: Illingworth & Rodkin, 2023, Table 8 in Attachment A. 1 CO2e is carbon dioxide equivalent units, the standard measure of total greenhouse gasses. 2 Standard practice is to divide the construction emissions by 40 years (an average building life) and add that to the operational emissions for comparison to thresholds. 3 Service Population was calculated at approximately 300 square feet per employee for office/R&D. 4 The emissions in this table are gross emissions for the proposed project with no reduction to account for existing uses and emissions. As shown in Table 6 above, quantified GHG emissions would be below the relevant efficiency threshold and therefore consistent with the less than significant impact conclusion. b) Greenhouse Gas Reduction Plans With respect to GHG emissions, the Clean Air Plan includes a goal to reduce Bay Area GHG emissions 40 percent below 1990 levels by 2030, and 80 percent below 1990 levels by 2050. This is consistent with the target reductions intended to be met by the BAAQMD thresholds and the City’s CAP. As demonstrated under criterion a) above, the project would be consistent with BAAQMD thresholds and the City’s CAP and would therefore be consistent with the GHG emissions reduction goal of the Clean Air Plan. Additionally, emissions associated with the development of the proposed project were analyzed per the BAAQMD May 2017 CEQA Air Quality Guidelines, as updated. BAAQMD’s thresholds and methodologies take into account implementation of state-wide regulations and plans, such as the AB 32 Scoping Plan, as updated, and adopted state regulations such as Pavley and the low carbon fuel standard. Therefore, the impact would be less than significant with respect to consistency with GHG reduction plans. Page 52 800 Dubuque Avenue Project Initial Study/MND 9. HAZARDS AND HAZARDOUS MATERIALS Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Create a significant hazard to the public or the environment through the routine transport, use, or disposal of hazardous materials? ց b) Create a significant hazard to the public or the environment through reasonably foreseeable upset and accident conditions involving the release of hazardous materials into the environment? ց c) Emit hazardous emissions or handle hazardous or acutely hazardous materials, substances, or waste within one-quarter mile of an existing or proposed school? ց d) Be located on a site which is included on a list of hazardous materials sites compiled pursuant to Government Code Section 65962.5 and, as a result, would it create a significant hazard to the public or the environment? ց e) For a project located within an airport land use plan or, where such a plan has not been adopted, within two miles of a public airport or public use airport, would the project result in a safety hazard for people residing or working in the project area? ց f) Impair implementation of or physically interfere with an adopted emergency response plan or emergency evacuation plan? ց g) Expose people or structures, either directly or indirectly, to a significant risk of loss, injury or death involving wildland fires? ց This section utilizes information from the Phase I Environmental Site Assessment prepared for the applicants by Ramboll US Consulting, Inc., dated January 2021, and the draft Soil and Groundwater Management Plan prepared by Langan Engineering and Environmental Services, Inc., dated July 15, 2021, which are available as part of project materials on file with the City. a) Routine Use of Hazardous Materials It is likely that equipment used at the site during construction activities could utilize substances considered by regulatory bodies as hazardous, such as diesel fuel and gasoline. However, all construction activities would be required to conform with Title 49 of the Code of Federal Regulations, US Department of Transportation, State of California, and local laws, ordinances and procedures. While specific tenants have not yet been identified, any commercial uses would involve household hazardous waste such as cleaners. Biotech and pharmaceutical research laboratories typically use limited quantities of materials considered to be biological hazards and/or chemical hazards. The San 800 Dubuque Avenue Project Initial Study/MND Page 53 Mateo County Environmental Health Division enforces regulations pertaining to safe handling and proper storage of hazardous materials to prevent or reduce the potential for injury to human health and the environment. Occupational safety standards exist in federal and state laws to minimize worker safety risks from both physical and chemical hazards in the workplace. The California Division of Occupational Safety and Health Administration is responsible for developing and enforcing workplace safety standards and ensuring worker safety in the handling and use of hazardous materials. With compliance with applicable regulations, project construction and operations are not anticipated to create a significant hazard to the public or environment through the routine transport, use or disposal of hazardous materials (less than significant). b, d) Hazardous Materials Site and Accidental Release The project site is not identified as a listed hazardous materials site pursuant to Section 65962.5 of the Government Code.17 The site was first developed in 1925 for use by Fontana Food Products Co. as a macaroni factory. By 1950 until 1982, the site was occupied by Dubuque Packing Co., a meat packing facility. A subsurface investigation conducted in 2015 sampled soil and groundwater from areas adjacent to a former 15,000-gallon fuel oil underground storage tank (UST). There was one detection of total petroleum hydrocarbons (TPH) from a depth of 5 feet below ground surface in the area of the former UST above applicable residential environmental screening levels (ESLs), however, the sample collected from the area near the base of the tank did not exceed ESLs indicating that the shallower contamination was not a result of a leaking UST. There were low-level detections of volatile organic compounds (VOCs) and metals in the soil that were either below ESLs or typical of background concentrations in the Bay Area. The groundwater samples collected from each boring did not detect TPH in any of the samples. The report concluded that there was no widespread contamination at the site and that no further investigation was needed at the time. The site was redeveloped in 1986 into a commercial multi-tenant facility, and likely regraded at that time. A comprehensive soil and groundwater investigation was completed in 2021 by Langan. More than 100 soil samples were obtained from 20 borings across the site with samples occurring at approximately 5-foot intervals to approximately 60 feet below ground surface. No Class I Resource Conservation and Recovery Act (RCRA) or non-RCRA hazardous material was detected in the site soils. Low detections of VOCs, SVOCs, TPH, and metals were found in select borings that exceeded Tier 1 ESLs, primarily in the upper 5 feet. Metals detections were sporadic throughout the site and slightly above either Tier 1 ESLs or typical background metal concentrations for the Bay Area. Based on the extensive sampling done across the site and soluble testing completed, the elevated metal concentrations are not anticipated to present a restriction when disposing of the soil. All remaining material will likely be excavated and disposed of as unrestricted waste depending on the disposal facility’s acceptance criteria or reused on site. Groundwater was sampled from five borings as a part of this investigation. Based on the recorded groundwater elevations at the site and proposed excavation, dewatering activities will be needed during excavation activities, and, depending on the method of discharge pre-treatment may be required. 17 State Water Resources Control Board GeoTracker Database, website accessed 8/6/2022 at http://geotracker.waterboards.ca.gov/; Department of Toxic Substances Control EnviroStor Database, website accessed 8/6/2022 at http://www.envirostor.dtsc.ca.gov/public/. Page 54 800 Dubuque Avenue Project Initial Study/MND In all, the site history, supported by several in-depth environmental investigations of the site support the finding that minimal impacts due to hazardous materials at the site exist but the existence of residual soil and groundwater impacts are sufficient to warrant health and safety measures and a soil management plan during excavation and construction activities, which are tailored to control fugitive dust that may contain residual hazardous materials and groundwater treatment as needed to neutralize any residual contaminants in dewatering groundwater before discharge. Mitigation Measure Haz-1 is tailored to address these specific risks. Mitigation Measure Haz-1: Implement Soil Management and Health and Safety Plans. The applicant’s construction contractor shall implement soil management and health and safety plans to facilitate compliance with applicable federal, state, and local laws and regulations, applicable to earthwork activities at the site as a result of the reported petroleum hydrocarbons and volatile organic compound concentrations in the soil. These plans must be filed with the City before construction permits are granted and are anticipated to include the following components: 1. Soil Management Plan. Recent analytical results indicate that some site soils contain slightly elevated concentrations of SVOCs, VOCs, TPH, and certain metals. The soil management objectives for the site are to minimize exposure of potentially hazardous constituents in soil to construction workers, nearby residents and pedestrians, and future users of the site. A site-specific soil management plan will be developed based on recent comprehensive subsurface investigations covering the site soils to depths exceeding planned excavations and the underlying groundwater. The soil management plan is intended to facilitate compliance with relevant federal, state, and local laws and regulations, applicable to earthwork activities at the site as a result of the identified contamination profiles. Some of the excavated material in the upper 5 feet may need to be disposed off-site at a Class II non-hazardous regulated landfill and/or as unrestrictive waste based on disposal facility’s acceptance criteria. The contractor will establish appropriate off-site disposal locations and direct truck loading scheduling and tracking and recording of all shipments per applicable regulations and/or stockpile locations on the site to properly segregate, cover, moisture control, and profile the excavated material. Further testing may instead determine that no special soil handling is required. Unless from a documented clean source such as a quarry, soil imported onto the site will be tested in accordance with the “Clean Imported Fill Material” information advisory developed by the California DTSC in October 2001. 2. Health and Safety Plan. The potential health risk to on-site construction workers and the public will be minimized by developing and implementing a comprehensive Health and Safety Plan (HASP). The contractor will be responsible for developing and implementing the HASP. The HASP plan will describe the health and safety training requirements, specific personal hygiene, and monitoring equipment that will be used during construction to 800 Dubuque Avenue Project Initial Study/MND Page 55 protect and verify the health and safety of the construction workers and the general public from exposure to constituents in the soil, which is anticipated to include the following: x the site will be fenced; x exposed soil at the construction site will be watered at least twice daily to prevent visible dust from migrating off-site; x stockpiles will be covered; x water will be misted or sprayed during loading of material onto trucks for off haul; x trucks transporting contaminated material will be covered with a tarpaulin or other cover; x the wheels of the trucks exiting the site will be cleaned prior to entering public streets; x public streets will be swept daily if material is visible, excavation and loading activities will be suspended if winds exceed 15 miles per hour; and the fence will be posted with requirements of the safe drinking water and toxic enforcement act (Proposition 65). 3. Health and Safety Officer. A site health and safety officer identified in the Health and Safety Plan will be on site at all times during excavation activities to ensure that all health and safety measures are maintained. The health and safety officer will have authority to direct and stop (if necessary) all construction activities in order to ensure compliance with the health and safety plan. 4. Dust Control. During all excavation activities, dust control measures will be implemented to reduce potential exposure. These measures may include moisture conditioning the soil and covering exposed soil and stockpiles with weighted down plastic sheeting to prevent exposure of the soil. Dust control measures at a minimum will include: x Covering soil stockpiles with plastic sheeting. x Watering uncovered ground surface at the site; use of water will be limited to prevent runoff. x Misting or spraying of soil during excavation and loading. x Emplacement of gravel and/or rubble plates on site access roads as feasible. x Trucks hauling soil from the site will be covered. x Visible dust will be monitored during excavation and subsurface demolition. x The soil drop height from an excavator’s bucket onto soil piles or into transport trucks will be minimized. x Windbreaks will be deployed as necessary. x If necessary, the area of excavation may be limited to reduce dust generation. x Site vehicle speed limits. Page 56 800 Dubuque Avenue Project Initial Study/MND x Street sweeping. x Termination of excavation if winds exceed 25 mph. x Addition of soil stabilizers and other responses as needed. 5. Odor Control. If strong odors are noted during excavation activities, odor suppression measures will be implemented by the General Contractor to minimize odor during excavation activities. 6. Storm Water Pollution Controls. Storm water pollution controls will be implemented to minimize storm water runoff and sediment transport from the site. A Storm Water Pollution Prevention Plan (SWPPP) will identify Best Management Practices for activities as specified by the California Storm Water Best Management Practices Handbook (Stormwater Quality Task Force, 1993) and/or the Manual of Standards for Erosion and Sediment Control Measures (ABAG, 1995). The SWPPP will include protocols (i.e., earth dikes and drainage swales) to control storm water contact with, or runoff from potentially impacted soil during wet weather conditions. 7. Groundwater Management. Groundwater at the site has been encountered at depths of nine feet to fifteen feet below ground surface. Construction dewatering is anticipated based on development plans. Any construction dewatering must adhere to a discharge permit obtained from the South San Francisco Department of Public Works Water Quality Control Division, Environmental Compliance Program or the Regional Water Quality Control Board. Based on the analytical results, the groundwater may need to be treated prior to discharge. Any proposed groundwater treatment prior to discharge will require analytical testing and approval from the appropriate regulatory agency prior to discharging. 8. Contingency Plans for Unknown/Unexpected Conditions. The following tasks shall be implemented during excavation activities if unknown historical subsurface features and/or unanticipated hazardous materials are encountered. Such materials may include unaccounted for underground storage tanks (UST) and associated product lines, sumps, and/or vaults, former monitoring wells, and/or soil with significant petroleum hydrocarbon odors and/or stains. x Stop work in the area where the suspect material is encountered and cover with plastic sheets. x Notify the General Contractor’s site safety officer and site superintendent. x Review the existing health and safety plan for revisions, if necessary, and have appropriately trained personnel on-site to work with the affected materials, once directed by the General Contractor. 9. Soil and Groundwater Management Completion Report. A Soil and Groundwater Management Completion Report (SGMCR) will be prepared that summarizes the soil and groundwater management activities and any subsequent investigative and removal activities that were completed during redevelopment. The SGMCR will present a chronology of the construction 800 Dubuque Avenue Project Initial Study/MND Page 57 events, a summary of analytical data, a copy of all manifests from the site, and a description of all soil and groundwater management activities at the site. The report will also contain laboratory analytical results and figures, as appropriate, to provide detail regarding the amount and type of contamination encountered (if any) during various activities. The report will also summarize any residual contaminants that were left on the site after completion of redevelopment activities and document that soil handling procedures were implemented in accordance with this mitigation measure. Implementation of Mitigation Measure Haz-1 would reduce the impacts associated with upset or accidental release related to a hazardous materials site to a level of less than significant with mitigation. Routine use of hazardous materials as a part of construction activities and operations are discussed under this Section 9(a) above. c) Hazardous Materials Near Schools No school is located within one-quarter mile of the project site. No hazardous materials with the potential for release during operation would be handled on or emitted from the site. Construction activities are discussed above. Therefore, the project would have no impact with respect to hazardous materials near schools. e) Airport Hazards The closest airport is the San Francisco International Airport (SFO), approximately 2 miles from the project site. The project site is within the boundary of the SFO Airport Land Use Consistency Plan (ALUCP) and as such, the compatibility criteria contained within the ALUCP are applicable to development at the project site. Most of the East of 101 Area, including the project site, is located outside of the ALUCP-designated Safety Compatibility zone that would have restricted types of uses, so the main applicable restrictions are height limitations. Development on the project site is limited to maximum heights of 261 feet above mean sea level but could be modified through consultation with the Federal Aviation Administration (FAA).18 Factoring in the height of the site, the applicant estimates that the proposed project would reach heights of about 218 feet above mean sea level plus additional rooftop elements, all of which would be below the lowest FAA height limit at the site of 261 feet. The project is consistent with airport-related building safety policies identified in the ALUCP. Notification and consultation with the FAA would be required under CFR part 77.9 and would ensure that the project is compatible with the SFO ALUCP. Therefore, this impact would be less than significant. f) Emergency Response Plan The project would not include any changes to existing public roadways that provide emergency access to the site or surrounding area. The proposed project would be designed to comply with the 18 City/County Association of Governments of San Mateo County, November 2012, Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport, including Exhibit IV-14. Available at: http://ccag.ca.gov/wp-content/uploads/2014/10/Consolidated_CCAG_ALUCP_November-20121.pdf Page 58 800 Dubuque Avenue Project Initial Study/MND California Fire Code and the City Fire Marshal’s code requirements that require on site access for emergency vehicles, a standard condition for any new project approval. No substantial obstruction in public rights-of-way has been proposed with the project’s construction activities. However, any construction activities can result in temporary intermittent roadway obstructions, but these would be handled through standard procedures with the City to ensure adequate clearance is maintained. Therefore, with compliance with applicable regulations and standard procedures, the impact with respect to impairment or interference with an Emergency Response or Evacuation Plan would be less than significant. g) Wildland Fire The project site is in a highly developed industrial/commercial area, and no wildlands are intermixed within this urban area. The closest wildlands area is San Bruno Mountain County Park located over 3,000 feet away, which is considered to have moderate to high (not very high) fire hazard. The proposed project would not exacerbate wildfire risks of any nature, would not substantially impair an adopted emergency evacuation plan or emergency response plan, and is not located in or near a Local or State Responsibility area with a Very High Fire Hazard Severity Zone designation.19, 20 The project is not susceptible to significant risk of loss, injury or death involving wildland fires and there would be no impact in this regard. 19 California Department of Forestry and Fire Protection. 2007. San Mateo County Fire Hazard Severity Zones in SRA. Available: https://osfm.fire.ca.gov/divisions/wildfire-planning-engineering/wildland-hazards-building-codes/fire-hazard-severity- zones-maps/. 20 Department of Forestry and Fire Protection Fire and Resource Assessment Program, San Mateo County Very High Fire Hazard Severity Zones in Local Responsibility Area, November 24, 2008, available at: https://osfm.fire.ca.gov/media/6800/fhszl_map41.pdf. 800 Dubuque Avenue Project Initial Study/MND Page 59 10. HYDROLOGY AND WATER QUALITY Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Violate any water quality standards or waste discharge requirements or otherwise substantially degrade surface or ground water quality? ց b) Substantially decrease groundwater supplies or interfere substantially with groundwater recharge such that the project may impede sustainable groundwater management of the basin? ց c) Substantially alter the existing drainage pattern of the site or area, including through the alteration of the course of a stream or river, or through the addition of impervious surfaces, in a manner which would: i) result in substantial erosion or siltation on- or off-site; ii) substantially increase the rate or amount of surface runoff in a manner which would result in flooding on- or off-site; iii) create or contribute runoff water which would exceed the capacity of existing or planned stormwater drainage systems or provide substantial additional sources of polluted runoff; or ց d) In flood hazard, tsunami or seiche zones, risk release of pollutants due to project inundation? ց e) Conflict with or obstruct implementation of a water quality control plan or sustainable groundwater management plan? ց This section utilizes information from the Draft Dewatering Assessment prepared by Langan and dated September 2, 2022, which is available as part of project materials on file with the City. a) Water Quality and Discharge Construction Period Construction activities have the potential to impact water quality through erosion and through debris and oil/grease carried in runoff which could result in pollutants and siltation entering stormwater runoff and downstream receiving waters if not properly managed. The project would be required to obtain coverage under the General Construction Activity Storm Water Permit (General Construction Permit) issued by the State Water Resources Control Board. Coverage under this permit requires preparation of a Stormwater Pollution Prevention Plan (SWPPP) for review and approval by the City.21 At a minimum, the SWPPP would include a description of construction 21 SWRCB, Construction General Permit Order 2009-0009-DWQ (Construction General Permit) Page 60 800 Dubuque Avenue Project Initial Study/MND materials, practices, and equipment storage and maintenance; a list of pollutants likely to contact stormwater; a list of provisions to eliminate or reduce discharge of materials to stormwater; best management practices (BMPs); and an inspection and monitoring program. Furthermore, the County of San Mateo’s Water Pollution Prevention Program would require the project site to implement BMPs during project construction to reduce pollution carried by stormwater such as keeping sediment on site using perimeter barriers and storm drain inlet protection and proper management of construction materials, chemicals, and wastes on site. Additional BMPs required by South San Francisco Municipal Code Section 14.04.180 would also be implemented during project construction. Per standard City procedures, compliance with SWPPP requirements and BMPs would be verified during the construction permitting process. As discussed in more detail in the Section 7: Geology and Soils, project construction activities would require substantial excavation and related dewatering activities, which would need to then be discharged. To minimize the need for dewatering, the project is proposing shoring using continuous DSM walls for temporary excavation support, which act to temporarily cut off groundwater infiltration through the sides of the excavation, resulting in the need for less dewatering. As discussed in more detail in Section 9: Hazards and Hazardous Materials, contaminants were detected in the groundwater above commercial screening levels for groundwater not used as a drinking water resource or for aquatic habitat. Per the analytic results of the groundwater sampling, it is anticipated the groundwater from site dewatering will need to be analyzed and possibly treated to be able to be discharged into the sanitary sewer system. Any construction dewatering must adhere to a discharge permit obtained from the South San Francisco Department of Public Works Water Quality Control Division, Environmental Compliance Program or the Regional Water Quality Control Board. The groundwater would be pumped into appropriate containers and samples obtained for chemical analyses and appropriate treatment prior to disposal, if needed. Mitigation Measures Geo-1 and Haz-1 would require construction techniques to minimize necessary dewatering and appropriate handling of dewatering and would also reduce the potential impact related to water quality and discharge. Compliance with a design-level Geotechnical Investigation and Structural Design Plans, as required by Mitigation Measure Geo-1 and implementation of groundwater management as required by Mitigation Measure Haz-1 would reduce the potential impact related to water quality and discharge to a level of less than significant with mitigation. Operational Period Project operations have the potential to result in sources of stormwater pollutants such as oil, grease, and debris to stormwater drainage flowing over roadways and other impermeable surfaces and entering the city’s stormwater system, served by the City of South San Francisco’s Public Works Department, Maintenance Division. The project site drains to an existing storm drain system that outfalls to a tidally influenced channel that is connected to the San Francisco Bay. With the proposed improvements, runoff from the rooftop and parking areas would be retained and treated via bio-retention basins and flow-through planters. Federal Clean Water Act regulations require municipalities to obtain National Pollution Discharge Elimination System (NPDES) permits which outline programs and activities to control surface stormwater pollution. Municipalities, such as the City of South San Francisco, must eliminate or reduce “non-point” pollution, consisting of all types of substances generated as a result of urbanization (e.g. pesticides, fertilizers, automobile fluids, sewage, litter, etc.), to the “maximum extent practicable” (as required by Clean Water Act Section 402(p)(3)(iii)). Clean Water Act Section 800 Dubuque Avenue Project Initial Study/MND Page 61 402(p) and USEPA regulations (40 CFR 122.26) specify a municipal program of “best management practices” to control stormwater pollutants. Best Management Practices (BMP) refers to any kind of procedure or device designed to minimize the quantity of pollutants that enter the storm drain system. To comply with these regulations, each incorporated city and town in San Mateo County joined with the County of San Mateo to form the San Mateo County Water Pollution Prevention Program (SMCWPPP) in applying for a regional NPDES permit, which includes Provision C.3. 22 The C.3 requirements are intended to protect water quality by minimizing pollutants in runoff, and to prevent downstream erosion by: designing the project site to minimize imperviousness, detain runoff, and infiltrate runoff where feasible; treating runoff prior to discharge from the site; ensuring runoff does not exceed pre-project peaks and durations; and maintaining treatment facilities. Project applicants must prepare and implement a Stormwater Control Plan containing treatment and source control measures that meet the “maximum extent practicable” standard as specified in the NPDES permit and the SMCWPPP C.3 Guidebook. Project applicants must also prepare a Stormwater Facility Operation and Maintenance Plan and execute agreements to ensure the stormwater treatment and flow-control facilities are maintained in perpetuity. Project compliance with applicable State General Permit requirements, City ordinances, and County of San Mateo’s guidelines would not result in significant impacts on water quality and would not result in a violation of water quality standards. Impacts would be less than significant with respect to water quality and discharge. b) Groundwater Recharge and Supplies The project is located in a designated urban area within the Westside groundwater basin.23 The California Water Service (Cal Water) supplies water to the City of South San Francisco and would serve the project site. Cal Water’s Urban Water Management Plan (UWMP) anticipates future growth in the region, although the current project is not explicitly included. The majority of the water supply to the Cal Water South San Francisco District (i.e., approximately 80 percent from 2005-2019) is treated water purchased from the City and County of San Francisco’s Regional Water System (RWS), which is operated by the San Francisco Public Utilities Commission (SFPUC) and originates largely (85%) from the Hetch Hetchy watershed (surface water). Groundwater makes up approximately 20 percent of the water supply for the South San Francisco District, which comes from the “Westside Basin”, which underlies the South San Francisco District. The Basin is currently categorized by the California Department of Water Resources as a very low priority basin and as such, the Basin is not subject to the requirements of the California Sustainable Groundwater Management Act though the Basin has been actively managed for years, including the establishment of pumping limitations.24 As discussed in more detail in Section 19: Utilities and Service Systems, a Water Supply Assessment was done for the project and is included in the project materials on file with the City. 22 Regional Water Board, 2007, Order No. R2-2007-0027, NPDES Permit No. CAS0029921. 23 California Regional Water Quality Control Board San Francisco Bay Region, San Francisco Bay Basin Water Quality Control Plan (Basin Plan), November 2019. 24 California Water Service (Cal Water), adopted June 2021, 2020 Urban Water Management Plan: South San Francisco District., available at: https://www.calwater.com/docs/uwmp2020/SSF_2020_UWMP_FINAL.pdf. Page 62 800 Dubuque Avenue Project Initial Study/MND The site is currently developed and therefore consists primarily of impervious surfaces, with landscaping along the frontage and in the parking lot areas. The project would result in a decrease of impervious surfaces with the addition of areas of permeable paving and construction of a new above and below ground drainage system that includes catch-basins, storm drainpipe, bio-retention areas, and flow-through planters to capture, treat, and discharge runoff from the entire site. The proposed drainage system would maintain the existing flow discharge pattern. As discussed in more detail in the Section 7: Geology and Soils, project construction activities would require substantial excavation and up to 18 months of related dewatering activities. Because groundwater at the site is not used for drinking water or for aquatic habitat and draw-down from dewatering activities would be temporary, this would not be considered a significant impact on groundwater supplies. As discussed under this Section 10(a) above, the project would comply with stormwater drainage requirements, including bio-retention/treatment areas to address both quality and volumes of runoff and is consistent with expected use of the site in basin planning. The project would not substantially deplete groundwater supplies or interfere substantially with groundwater recharge, and would have a less than significant impact related to groundwater. Because groundwater in the vicinity of the project site is not used as a drinking water source and is derived from the Bay, the potential to deplete groundwater supplies is considered a less than significant impact and no mitigation is required. c) Drainage Pattern Alteration The site is currently developed and therefore consists almost entirely of impervious surfaces across the 5.89-acre site. The project would result in approximately 4.63 acres of impervious surface (79% of the site). There are existing storm drainpipes on the project site, located on the long sides of the existing buildings. The project is proposing to remove the existing storm drainpipes and replace them with new drainpipes along all four sides of the project site. In compliance with City requirements, the project would implement low-impact development stormwater management best practices to minimize runoff and encourage stormwater infiltration, including using concrete-lined flow-through planters to manage stormwater on the project site. An on-site storm drain detention system would be provided to limit flows into the public storm drain system to pre-project conditions, in accordance with City requirements. As discussed under this Section 10(a) above, through compliance with applicable regulations, runoff from site would be the same or reduced from that existing and would not cause erosion, siltation, pollution, or flooding and as discussed above, changes to on-site conditions would meet applicable requirements and would not exceed capacity of the stormwater drainage system or result in on- or off-site flooding. Project impacts related to alteration of drainage patterns would be less than significant. 800 Dubuque Avenue Project Initial Study/MND Page 63 d) Inundation The project site is approximately 1 to 1.5 miles from the San Francisco Bay and approximately 5 miles from the Pacific Ocean, and according to state hazard mapping is not located in a tsunami hazard area.25 The nearest body of water that could experience seiche (water level oscillations in an enclosed or partially enclosed body of water) is the San Francisco Bay located approximately 1 mile northeast and 1.5 miles east of the project site. A seiche would not experience run up higher than a tsunami and as discussed above, the site is not located in a tsunami hazard area and is therefore not in an area at risk for seiche inundation either. No other large bodies of water with the potential to inundate the project site by a seiche are located near the site. The project is not located within Federal Emergency Management Agency (FEMA) Flood Zone and is therefore not at substantial risk of flooding from 100-year or more common storms.26 Therefore, the proposed project would not result in the risk of release of pollutants due to inundation by a tsunami, seiche, or flooding and the project impact in this regard would be less than significant. e) Implementation of Plans As discussed under this Section 10(a) above, the project would comply with applicable requirements under the General Construction Activity Storm Water Permit, County of San Mateo’s Water Pollution Prevention Program, National Pollution Discharge Elimination System (NPDES), which are intended to implement relevant laws and plans related to water quality. As discussed under this Section 10(b) above, the local groundwater basin is not required to comply with the Sustainable Groundwater Management Act. The project would not otherwise conflict with Cal Water’s Urban Water Management Plan or groundwater management and the project impact with respect to implementation of plans would be less than significant. 25 California Geological Survey, 2021, Tsunami Hazard Area Map, San Mateo County, available at: https://www.conservation.ca.gov/cgs/tsunami/maps. 26 Federal Emergency Management Agency (FEMA), effective 4/5/2019, Flood Insurance Rate Map (FIRM), Map Number 06081C0042F, available at https://www.fema.gov/flood-maps. Page 64 800 Dubuque Avenue Project Initial Study/MND 11. LAND USE AND PLANNING Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Physically divide an established community? ց b) Cause a significant environmental impact due to a conflict with any land use plan, policy, or regulation adopted for the purpose of avoiding or mitigating an environmental effect? ց a) Physical Division of a Community The project site is in an urbanized area surrounded by developed parcels and infrastructure. The site is a development parcel and does not act as a connection point for other parcels. The project would not involve any physical changes that would have the potential to divide an established community and there would therefore be no impact in this regard. b) Conflict with Land Use Plan An environmental impact could occur when a project conflicts with a policy or regulation intended to avoid or reduce an environmental impact. The following discussion does not replace or preclude a consistency assessment for project approval considerations, which take into account more than potential impacts to the environment. The proposed project conforms to the updated height, density and use controls in the ShapeSSF General Plan 2040 for the East of 101 Transit Core designation. The site is zoned for East of 101 Transit Core use, under which R&D and office uses are permitted, and the project otherwise conforms with the height and density controls of the zoning code. Therefore, the project would have a less than significant impact with regard to land use plan conflicts. 800 Dubuque Avenue Project Initial Study/MND Page 65 12. MINERAL RESOURCES Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Result in the loss of availability of a known mineral resource that would be of value to the region and the residents of the state? ց b) Result in the loss of availability of a locally-important mineral resource recovery site delineated on a local general plan, specific plan or other land use plan? ց a, b) Mineral Resources The site contains no known mineral resources and has not been delineated as a locally important mineral recovery site on any land use plan.27 The project would have no impact related to mineral resources. 27 U.S. Geological Survey, Mineral Resources Data System: U.S. Geological Survey, Reston, Virginia. Accessed August 2022, at: http://tin.er.usgs.gov/mrds/ Page 66 800 Dubuque Avenue Project Initial Study/MND 13. NOISE Would the project result in: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Generation of a substantial temporary or permanent increase in ambient noise levels in the vicinity of the project in excess of standards established in the local general plan or noise ordinance, or applicable standards of other agencies? ց b) Generation of excessive groundborne vibration or groundborne noise levels? ց c) For a project located within the vicinity of a private airstrip or an airport land use plan or, where such a plan has not been adopted, within two miles of a public airport or public use airport, would the project expose people residing or working in the project area to excessive noise levels? ց a, b) Excessive Noise or Vibration Noise and vibrations from construction depend on the noise generated by various pieces of construction equipment, the timing and duration of noise-generating activities, and the distance between construction noise sources and noise sensitive receptors. Construction noise impacts primarily occur when construction activities occur during noise-sensitive times of the day (early morning, evening, or nighttime hours), the construction occurs in areas immediately adjoining noise sensitive land uses, or when construction involves particularly noisy techniques, such as driven piles. The closest noise-sensitive receptors to the project site are the multi-family residences approximately 400 feet to the west on the other side of U.S. 101. The South San Francisco Noise Ordinance (Chapter 8.32 of the Municipal Code, Section 8.32.050) restricts construction activities to the hours of 8:00 AM to 8:00 PM on weekdays, 9:00 AM to 8:00 PM on Saturdays, and 10:00 AM to 6:00 PM on Sundays and holidays. This ordinance also limits noise generation of any individual piece of equipment to 90 dBA at 25 feet or at the property line. The project is not anticipated to require pile driving and the project’s construction activities would comply with the Noise Ordinance. With compliance with Noise Ordinance requirements, temporary construction-period noise and vibration impacts are considered less than significant. Operation of an office/R&D use would not be considered a noise-sensitive receptor and does not produce substantial levels of off-site vibration or noise. Rooftop equipment would be required to comply with the City’s Noise Ordinance, would be shielded as appropriate, and in any case, would not have the potential to generate noise levels above those of the U.S. 101 at receptors across the highway from the project site. Traffic-related noise impacts generally have the potential to occur with at least a doubling of traffic volumes on roadways adjacent to areas with noise sensitive uses that are already at or above acceptable noise conditions. The project is located proximate to U.S. 101 and would not require substantial trips to pass by noise sensitive uses other than on high- volume roadways such as U.S. 101, which carries substantially more than the volume of project 800 Dubuque Avenue Project Initial Study/MND Page 67 traffic under existing conditions and would therefore not experience a doubling in volume with the addition of project traffic. Operationally, the project itself would not be considered a source of substantial noise or vibration. Therefore, operation of the project would be less than significant. c) Airport Noise The closest airport to the project site is the San Francisco International Airport, approximately 2 miles to the south. The project site is within the boundary of the Airport Land Use Compatibility Plan (ALUCP), but is not within the area substantially impacted by airplane flyover noise (i.e., the Community Noise Equivalent Level 70 Noise Contours).28 Impacts related to excessive aircraft noise exposure would be less than significant. 28 City/County Association of Governments of San Mateo County, November 2012. Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport. Available at: http://ccag.ca.gov/wp- content/uploads/2014/10/Consolidated_CCAG_ALUCP_November-20121.pdf Page 68 800 Dubuque Avenue Project Initial Study/MND 14. POPULATION AND HOUSING Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Induce substantial unplanned population growth in an area, either directly (for example, by proposing new homes and businesses) or indirectly (for example, through extension of roads or other infrastructure)? ց b) Displace substantial numbers of existing people or housing, necessitating the construction of replacement housing elsewhere? ց a) Substantial Population Growth While neither housing nor population are directly created as a result of this project, employment opportunities can indirectly increase population and the demand for housing. The applicants project an employment density of 300 gross square footage per employee. Based on this, the project is estimated to introduce up to approximately 3,000 new jobs to the City of South San Francisco. Table 2-6 of the EIR for the ShapeSSF General Plan 2040 projects a growth of 17,978 jobs in the East of 101 Transit Core.29 The General Plan 2040 projects a growth of 59% from the population of 2018, with approximately 49,800 additional residents by 2040.30 The EIR for the General Plan 2040 determined that this population growth would have a less that significant impact. Plan Bay Area 2050 is the current regional long-range plan charting the course for the future of the nine-county San Francisco Bay Area. Plan Bay Area 2050 focuses on four key issues — the economy, the environment, housing, and transportation. Plan Bay Area 2050 estimates a total of 5,408,000 total jobs to the Bay Area by 2050 (an addition of 1,403,000 jobs between 2015 and 2050).31 The project’s addition of up to 3,000 employees would increase jobs in the City and region incrementally. Compared to the total jobs projection for the entire Bay Area, the addition of 3,000 jobs would not be substantial. The location of an employment center close to regional transit (Caltrain) would be consistent with Plan Bay Area 2050 goals to locate more jobs near transit. Therefore, the project impact with respect to indirect population growth would be less than significant. b) Displacement of Housing or People There is currently no housing or people at the site that would be displaced by the project. The project would have no impact related to displacement of housing or people. 29 FirstCarbon Solutions, Draft Program Environmental Impact Report General Plan Update, Zoning Code Amendments, and Climate Action Plan, City of South San Francisco, San Mateo County, California. June 24, 2022. 30 City of South San Francisco, ShapeSSF General Plan 2040. February 2022. 31 Association of Bay Area Governments and Metropolitan Transportation Commission, Plan Bay Area 2050 Final Blueprint Growth Pattern, January 2021. Available at: https://www.planbayarea.org/digital-library/plan-bay-area-2050-final- blueprint-growth-pattern 800 Dubuque Avenue Project Initial Study/MND Page 69 15. PUBLIC SERVICES Would the project result in substantial adverse physical impacts associated with the provision of new or physically altered governmental facilities, need for new or physically altered governmental facilities, the construction of which could cause significant environmental impacts, in order to maintain acceptable service ratios, response times or other performance objectives for any of the following public services? Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Fire protection ց b) Police protection ց c) Schools ց d) Parks ց e) Other public facilities ց a-e) Public Services The proposed project is located on a developed site within the City of South San Francisco that is within the public services area, which includes South San Francisco Fire Department Station 62 located 1.2 miles away from the project site, and the South San Francisco Fire Department located 1.3 miles away. The project would not directly add population, and an office/R&D use would not be anticipated to substantially increase utilization of public services, such that new or physically altered facilities would be required. The minimal increases in demand for services expected with the worker population and potential indirect population growth (see Section 14: Population and Housing), would be offset through payment of development fees and annual taxes, a portion of which go toward ongoing provision of and improvements to public services. Therefore, the impact to public services would be less than significant. Page 70 800 Dubuque Avenue Project Initial Study/MND 16. RECREATION Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Increase the use of existing neighborhood and regional parks or other recreational facilities such that substantial physical deterioration of the facility would occur or be accelerated. ց b) Include recreational facilities or require the construction or expansion of recreational facilities which might have an adverse physical effect on the environment. ց a, b) Recreation The project proposes onsite open space in the form of landscaped areas and outdoor seating areas. The construction of onsite amenities has been included in the analysis in this document and would not result in significant impacts to the environment. The project would not otherwise construct or cause to be constructed parks or recreational facilities. All commercial development is required to pay development impact fees to the City, which helps fund City parks and recreation facilities and programs. The use of public recreational facilities would not be anticipated to increase substantially due to project employees such that physical deterioration would occur, or construction or expansion would be necessary. Therefore, the impact related to recreation would be less than significant. 800 Dubuque Avenue Project Initial Study/MND Page 71 17. TRANSPORTATION Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Conflict with a program, plan, ordinance or policy addressing the circulation system, including transit, roadway, bicycle, and pedestrian facilities? ց b) Would the project conflict or be inconsistent with CEQA Guidelines section 15064.3, subdivision (b)? ց c) Substantially increase hazards due to a geometric design feature (e.g., sharp curves or dangerous intersections) or incompatible uses (e.g., farm equipment)? ց d) Result in inadequate emergency services? ց This section utilizes information from the Transportation Analysis prepared for this analysis by Hexagon Transportation Consultants, Inc., included in full as Attachment D. a) Circulation System Plans and Facilities The Transportation Analysis assessed pedestrian, bicycle, and transit access and circulation and consistency with applicable regulations. Pedestrians: Sidewalks and crosswalks are provided on most streets in the immediate vicinity of the proposed project. Sidewalks exist along the east side of Dubuque Avenue, on Grand Avenue and Airport Boulevard, with signalized intersections at Dubuque Avenue/Oyster Point and Dubuque Avenue/Grand Avenue. As part of the South San Francisco Caltrain Reconstruction Project that is currently in progress, an underpass was constructed that provides a direct connection for pedestrians and bicyclists between areas to the west and east of the Caltrain tracks. This underpass also provides a connection to the new Caltrain station platform. Currently, there is no ADA access from Dubuque Avenue to the Caltrain station platform, which is accessible by stairs, however, the 580 Dubuque project that is under development includes a condition of approval to provide a pedestrian route to the station that is ADA accessible. A significant impact would occur if the proposed project conflicted with applicable or adopted policies, plans or programs related to pedestrian facilities or otherwise decreased the performance or safety of pedestrian facilities. The project would not remove any pedestrian facilities nor conflict with Active South City, the City’s Bicycle and Pedestrian Master Plan. The South San Francisco General Plan requires project proponents to provide sidewalks and street trees as part of frontage improvements for new development. The project would reconstruct the sidewalk along its frontage on Dubuque Avenue in order to move it away from the curb and change it to a curving path through plantings and trees. Striped crosswalks would connect the sidewalk across both driveways. Therefore, the project would have a less than significant impact on the existing and planned pedestrian facilities. Page 72 800 Dubuque Avenue Project Initial Study/MND Bicyclists: Bicycle access to the project site is currently limited as there are no bike lanes on Dubuque Avenue. In the vicinity of the project, Class II bike lanes are located on Airport Boulevard (north of Miller Avenue), along Poletti Way, Gateway Boulevard (between E Grand Avenue and Airport Boulevard), along Sister Cities Boulevard, and along Oyster Point Boulevard (east of Gateway Boulevard). The new pedestrian/bicycle undercrossing provides bicycle access between East Grand Avenue /Poletti Way and Airport Boulevard, with direct access to the South San Francisco Caltrain station platform. The existing Caltrain Station access driveway on Dubuque Avenue would provide bicycle access between the Caltrain station and the project site. An impact to bicyclists would occur if the proposed project disrupted existing bicycle facilities or conflicted with or created inconsistencies with adopted bicycle system plans, guidelines, and policies. The project would not remove any bicycle facilities nor would it conflict with Active South City, which proposes upgrades to some of the existing bike lanes near the project site. Therefore, the impact to bicycle facilities would be less than significant. Transit: Existing transit service to the study area is provided by Caltrain, San Mateo County Transit District (SamTrans), Bay Area Rapid Transit (BART), Water Emergency Transit (WETA), and commuter shuttles. The project site is located less than 1/2-mile from the Caltrain station. Since the project is located close to the Caltrain station, it is expected to generate trips via transit services. According to state CEQA guidelines, the addition of new transit riders should not be treated as an adverse impact because such development also improves regional flow by adding less vehicle travel onto the regional network. Additionally, the recent Caltrain station improvement project has been planned to accommodate increases in ridership. Therefore, the project is anticipated to have a less than significant impact on transit facilities and services. The Zoning Code Amendments associated with the ShapeSSF General Plan 2040 included an updated TDM Ordinance. A TDM program is required for the proposed project to meet the TDM Ordinance, which requires a minimum of 50% alternative mode use (less than 50% single occupancy vehicles). TDM program measures further promote alternative modes, including pedestrian, bicycle, carpool, and transit options. Per Senate Bill 743 discussed under this Section 17(b) below, auto delay, level of service (LOS), and similar measures of vehicular capacity or traffic congestion are no longer considered as a basis for determining significant impacts under CEQA. The following discussion is provided for informational purposes and is based on the Local Transportation Analysis prepared by Hexagon Transportation Consultants, Inc., which is available as part of the project material on file with the City. The proposed project would generate an average of 5,635 new daily trips, with 815 new trips during the AM peak hour and 815 new trips during the PM peak hour. These trips rates factor in implementation of the required TDM program. The Local Transportation Assessment concluded that the project would not cause any study intersections or highway segments to degrade from acceptable operations to unacceptable operations with the exception of the intersection of Sister Cities Boulevard/Oyster Point Boulevard and Airport Boulevard, which would degrade to an unacceptable level during AM peak hours with the addition of project traffic to existing traffic volumes. Under cumulative conditions expected in 2040, six intersections studied would operate at unacceptable levels during at least one of the peak hours, with or without the addition of project traffic. The project would pay required Citywide Transportation Fees to offset any operational impacts on the City’s transportation system. The General Plan 2040’s Mobility Plan identifies several major transportation projects to improve traffic circulation in the East of 101 area, as most of the study intersections are already built to capacity. The Citywide Transportation Fee is a source of funding for transportation improvements such as those identified in the Mobility Plan. 800 Dubuque Avenue Project Initial Study/MND Page 73 b) Vehicle Circulation and Congestion Senate Bill (SB) 743 changed CEQA transportation impact analysis significance criteria to eliminate auto delay, level of service (LOS), and similar measures of vehicular capacity or traffic congestion as a basis for determining significant impacts under CEQA (although a jurisdiction may choose to maintain these measures under its General Plan). The changes in CEQA Guidelines to implement SB 743 present vehicles miles traveled (VMT) as an appropriate measure of transportation impacts. The City of South San Francisco provides VMT screening criteria for development projects. The criteria are based on the type of project, characteristics, and/or location. If a project meets the City’s screening criteria, the project is determined to result in less-than-significant impacts, and a detailed VMT analysis is not required. The City’s policy states that projects within 0.5 miles of an existing or planned high-quality transit corridor or major transit station should be presumed to have no impact on VMT. However, this presumption would not apply if the project FAR is less than 0.75, includes parking that is higher than required by the City, is inconsistent with Plan Bay Area, or replaces affordable residential units with a smaller number of market-rate units. The project site is located within 1/2 mile from the South San Francisco Caltrain Station. The project is proposing an FAR of approximately 3.33, does not exceed required parking spaces, and is consistent with the land use under the City’s 2040 General Plan and related zoning. Therefore, a detailed VMT analysis is not required and the impact with respect to VMT would be less than significant. Additionally, South San Francisco Municipal Code requires preparation and implementation of a TDM program, which requires a minimum of 50% alternative mode use (less than 50% single occupancy vehicles). Successful implementation of TDM program measures could serve to further reduce project VMT. c) Hazards The Transportation Analysis evaluated the sight distance at both project driveways on Dubuque Avenue. According to the South San Francisco Municipal Code, the speed limit on Dubuque Avenue is 30 mph. The sight distance was found to be adequate from either driveway looking right to the north on Dubuque Avenue with the removal of the existing signboards at the project driveways. However, sight distance looking left to the south is inadequate due to a slight curve to the road and line-of-sight obstructions, including a utility pole, vegetation, signage, and a metal fence. The project proposes to clear all line-of sight obstructions along the project site frontage on Dubuque Avenue, including the utility poles, which would be removed as part of the project’s proposal to underground approximately 462 linear feet of electrical line along the project’s Dubuque Avenue frontage. The following mitigation would improve the safety at both driveways. Mitigation Measure Trans-1: Demonstrate Adequate Sight Distance at Project Driveways. The applicant shall demonstrate to the satisfaction of the City that the sight distance is adequate at both project driveways, which could include but is not limited to the following measures: x Coordination with the City to decrease the speed limit on Dubuque Avenue to 25 mph. x Coordination with the City to remove all line-of-sight obstructions (vegetation, utility poles and sign boards) to create clear sight lines within the City’s right-of-way to the south of the project site. Page 74 800 Dubuque Avenue Project Initial Study/MND x Coordination with the adjacent property to the south (720 Dubuque Avenue/PG&E easement) to push back the existing metal fence on the southern boundary of the project site and remove vegetation to provide a clear zone to the south of the project’s southern driveway. With these improvements, the impact with respect to traffic hazards would be less than significant with mitigation. As is standard practice, landscaping installed along the roadway frontage near driveways should be maintained to be either low-lying or trees with canopies that do not fall below seven feet and parking should be restricted within 25 feet of the driveways. d) Emergency Access The proposed project would not reroute or change any of the city streets in its vicinity that would impact emergency vehicle access to properties along Dubuque Avenue. The proposed site access roadways would accommodate emergency vehicles. The project would have no impact with regard to inadequate emergency access. 800 Dubuque Avenue Project Initial Study/MND Page 75 18. TRIBAL CULTURAL RESOURCES Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Cause a substantial adverse change in the significance of a tribal cultural resource, defined in Public Resources Code section 21074 as either a site, feature, place, cultural landscape that is geographically defined in terms of the size and scope of the landscape, sacred place, or object with cultural value to a California Native American tribe, and that is: i) Listed or eligible for listing in the California Register of Historical Resources, or in a local register of historical resources as defined in Public Resources Code section 5020.1(k), or ii) A resource determined by the lead agency, in its discretion and supported by substantial evidence, to be significant pursuant to criteria set forth in subdivision (c) of Public Resources Code Section 5024.1. In applying the criteria set forth in subdivision (c) of Public Resource Code Section 5024.1, the lead agency shall consider the significance of the resource to a California Native American tribe. ց a) Tribal Cultural Resources A record search of the Native American Heritage Commission Sacred Lands File was completed for the project and indicated there are no known sacred lands present in the vicinity of the site (see Attachment B). While no tribes have requested notification of potential consultation opportunities for projects in this area, per recommendation of the Native American Heritage Commission, notice was sent to listed tribes on October 12, 2022. No responses were received within the required 30 day response period. The records search performed by the Northwest Information Center indicated that there is a moderate to high potential for the inadvertent discovery of previously unrecorded Native American resources based on the characteristics of the site and history of the region (see Attachment B). Although previous studies included field survey of the project site, significant excavation and below- grade levels are proposed, which would disturb previously-undisturbed native soils well below the field survey levels. Construction activities associated with the project would include excavation extending up to approximately 60 feet below the surface in the area of the parking garage. Mitigation Measures Cul-1, Cul-2, and Cul-3 would require proper handling of any discoveries and would also reduce the potential impact related to unknown tribal cultural resources. Compliance with the protection procedures specified in Mitigation Measures Cul-1, Cul-2, and Cul-3 would require that if any previously-unknown tribal cultural resources and/or human remains are discovered, these would be handled appropriately and the impact of the project would be less than significant with mitigation. Page 76 800 Dubuque Avenue Project Initial Study/MND 19. UTILITIES AND SERVICE SYSTEMS Would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Require or result in the relocation or construction of new or expanded water, or wastewater treatment or storm water drainage, electric power, natural gas, or telecommunications facilities, the construction or relocation of which could cause significant environmental effects? ց b) Have sufficient water supplies available to serve the project and reasonably foreseeable future development during normal, dry and multiple dry years? ց c) Result in a determination by the wastewater treatment provider which serves or may serve the project that it has adequate capacity to serve the project’s projected demand in addition to the provider’s existing commitments? ց d) Generate solid waste in excess of State or local standards, or in excess of the capacity of local infrastructure, or otherwise impair the attainment of solid waste reduction goals? ց e) Comply with federal, state, and local management and reduction statutes and regulations related to solid waste? ց a, b, c) Water, Stormwater, Wastewater, and Other Utilities Water As discussed in Section 10: Hydrology and Water Quality, the City of South San Francisco’s East of 101 Area is served by Cal Water through a combination of local groundwater and water purchased from SFPUC’s Hetch Hetchy System. Cal Water’s Urban Water Management Plan (UWMP), which plans for provision of water, anticipates future growth in the region, but does not explicitly include the project. Based on preliminary Fire Flow Calculations and results from Fire Flow Tests performed by Cal Water, the 6-inch water main in Dubuque Avenue has sufficient capacity to serve the project. Two new fire water services and one new domestic water service will be installed between the main and the buildings. A separate Water Supply Assessment (WSA) was prepared for the project per Senate Bill 610 through coordination between the City and Cal Water (available as part of the project materials on file with the City). The WSA, prepared by EKI Environment & Water, Inc., in August 2022, estimates the project’s net annual water demand to be approximately 189 acre-feet per year. Because this project was not explicitly accounted for in the SSF District 2020 UWMP, the water demand of the project was assumed to not be included in the projected SSF District water demands. 800 Dubuque Avenue Project Initial Study/MND Page 77 In 2021, Cal Water started a Development Offset Program, which requires any new residential, commercial, or industrial development within any of the three Peninsula Districts that is projected to demand more than 50 acre-feet per year to pay a special facilities fee per acre-feet of net demand increase, to fund projects that will increase supply reliability. The project would be responsible for offsetting its actual anticipated net demand, based on detailed calculations for the final project design. Cal Water would verify compliance with the Development Offset Program before establishing a water service connection to the project. With the offset of the net increase of water through payment of the special facilities fee, the project would not be expected to result in a net increase in water demands to Cal Water’s SSF District. Impacts with respect to water would be less than significant. 32, 33, 34 Wastewater The wastewater collection system that serves the project site is owned and operated by the City of South San Francisco. The nearest publicly-owned sewer system, which is owned and maintained by the City, is an 8-inch main located within a sewer easement along the southeastern property line of the project site. The project would construct two onsite sanitary sewer lines, as well as connections to the existing public sewer line to the east. The project is also proposing upsizing of the existing 8-inch sewer main to a 10-inch main approximately 1,400 linear feet along the project site and south to the existing 10-inch main that crosses the Caltrain tracks. The existing 10-inch sewer main across the Caltrain tracks (between manhole sJ2750 near the southern edge of the 720 Dubuque Avenue parcel and Poletti Way) has sufficient capacity, but is older and developing some deficiencies (pipe roughness and sags). The project is also proposing to rehabilitate this approximately 200 linear foot length in place, which could include sliplining, cured in place pipe, pipe bursting, or replacement of the existing pipe with a new 10-inch sewer main. It is anticipated that with the proposed sewer main improvements, there would be adequate capacity for the project and other anticipated potential future office/R&D development along the Dubuque Avenue corridor consistent with the ShapeSSF General Plan 2040. (If residential development is instead proposed along this corridor, further upsizing may be required.) The ShapeSSF General Plan 2040 EIR analyzed buildout of 14,100,523 new square feet of non- residential building space at full buildout and determined that no new or expanded wastewater treatment facilities would be required to provide services to the anticipated new buildout, including the current project.35 The impact related to required wastewater capacity would be less than significant. 32 California State Water Board, amended plan adopted December 12, 2021, Water Quality Control Plan for the San Francisco Bay/Sacramento-San Joaquin Delta Estuary, available at: https://www.waterboards.ca.gov/plans_policies/docs/2018wqcp.pdf . 33 BAWSCA, Water Reliability webpage, available at: https://bawsca.org/water/reliability 34 California Water Service (Cal Water), adopted June 2021, 2020 Urban Water Management Plan: South San Francisco District., available at: https://www.calwater.com/docs/uwmp2020/SSF_2020_UWMP_FINAL.pdf. 35 FirstCarbon Solutions, Draft Program Environmental Impact Report General Plan Update, Zoning Code Amendments, and Climate Action Plan, City of South San Francisco, San Mateo County, California. June 24, 2022. Page 78 800 Dubuque Avenue Project Initial Study/MND Stormwater As discussed in Section 10: Hydrology and Water Quality, the proposed drainage system would maintain the existing flow discharge pattern and connect to the existing storm drain system operated and maintained by the City of South San Francisco. The existing storm drainpipes on site would be removed and replaced by new storm drainpipes that would loop around the building. In compliance with City requirements, the project would implement low-impact development stormwater management best practices to minimize runoff and encourage stormwater infiltration, including using concrete-lined flow-through planters to manage stormwater on the project site. As redevelopment on a currently developed site, the project would result in a decrease in impervious surface (to 79% of the site) and would construct a new above and below ground drainage system that includes catch-basins, storm drainpipe, bio-retention areas, and flow-through planters to capture, treat, and discharge runoff from the entire site. With an increase of pervious surface area and on-site storm drainage infrastructure that would reduce the existing runoff rate, the project would reduce demand on the storm drainage facilities compared to existing conditions. Impacts with respect to stormwater would be less than significant. Electricity, Natural Gas, and Telecommunications As discussed in Section 6: Energy, the project would not result in the wasteful, inefficient, or unnecessary consumption of energy. In addition, the project would not require the construction of new electric power, natural gas, or telecommunications facilities because it is located in an urban area already served by those utilities. The project proposes to underground the electrical lines along the project’s frontage on Dubuque Avenue (approximately 462 linear feet) in coordination with PG&E. This is consistent with Policy LU-8.10 of the ShapeSSF General Plan 2040, which includes undergrounding new and existing utilities when feasible.36 The project would be designed to operate on 100% electric energy. As an infill site in applicable service areas, the project impacts with respect to electricity, natural gas, and telecommunications would be less than significant. d, e) Solid Waste and Solid Waste Reduction South San Francisco Scavenger Company, Inc. (SSFSC) manages all trash and recycling services in South San Francisco. SSFSC collects, receives, processes, and recycles (or transfers for landfill disposal) over 250,000 tons of waste a year.37 Of all solid waste generated, approximately 84 percent is sent to the Corinda Los Trancos Landfill (Ox Mountain) in Half Moon Bay, California. The Corinda Los Trancos Landfill (Ox Mountain) accepts up to 3,598 tons per day and is anticipated to have available capacity until 2034.38 36 City of South San Francisco, 2040 General Plan. February 2022. 37 South San Francisco Scavenger Company, Inc. website, “About Us”, available at: https://ssfscavenger.com/about-us/, accessed August 2022. 38 California Department of Resources Recycling and Recovery (CalRecycle), 2019, SWIS Facility Detail: Corinda Los Trancos Landfill (Ox Mtn) (41-AA-002), https://www2.calrecycle.ca.gov/SolidWaste/SiteActivity/Details/1561?siteID=3223, accessed August 2022. 800 Dubuque Avenue Project Initial Study/MND Page 79 The proposed project would generate solid waste during construction and operation. Handling of debris and waste generated during construction would be subject to SSFMC Section 8.16 coordination with Scavengers Company; and SSFMC Section 15.22.030 diversion of at least 65 percent of construction or demolition waste. The project would generate approximately 68.39 tons of waste per year, or approximately 0.19 tons per day. The estimate is conservative as it does not factor in any recycling or waste-diversion programs. The 0.19 tons of solid waste generated daily by the project would represent less than 0.001 percent of the permitted landfill throughput.39 The City of South San Francisco is required to meet the statewide waste diversion goal of 50 percent set by AB 939. The proposed project would comply with federal, state, and local statutes and regulations related to solid waste, such as AB 939, the SSFMC, and the City’s recycling program. Impacts related to solid waste and waste facilities would be less than significant. 39 Solid waste estimated from CalEEMod output in Attachment A. Page 80 800 Dubuque Avenue Project Initial Study/MND 20. WILDFIRE If located in or near state responsibility areas or lands classified as very high fire hazard severity zones, would the project: Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Substantially impair an adopted emergency response plan or emergency evacuation plan? ց b) Due to slope, prevailing winds, and other factors, exacerbate wildfire risks, and thereby expose project occupants to, pollutant concentrations from a wildfire or the uncontrolled spread of a wildfire? ց c) Require the installation or maintenance of associated infrastructure (such as roads, fuel breaks, emergency water sources, power lines or other utilities) that may exacerbate fire risk or that may result in temporary or ongoing impacts to the environment? ց d) Expose people or structures to significant risks, including downslope or downstream flooding or landslides, as a result of runoff, post-fire slope instability, or drainage changes? ց a-d) Wildfire Risk and Emergency Response The project site is located within an urbanized area of the City of South San Francisco and is surrounded by existing industrial/commercial development and infrastructure. Neither the project site nor the City of South San Francisco is identified as being within a state responsibility area or a very high fire hazard severity zone.40, 41 The proposed project would have no impact related to wildfire. 40 California Department of Forestry and Fire Protection. 2007. San Mateo County Fire Hazard Severity Zones in State Responsibility Area. Available: https://osfm.fire.ca.gov/divisions/wildfire-planning-engineering/wildland-hazards-building- codes/fire-hazard-severity-zones-maps/. 41 Department of Forestry and Fire Protection Fire and Resource Assessment Program, San Mateo County Very High Fire Hazard Severity Zones in Local Responsibility Area, November 24, 2008, available at: https://osfm.fire.ca.gov/media/6800/fhszl_map41.pdf. 800 Dubuque Avenue Project Initial Study/MND Page 81 21. MANDATORY FINDINGS OF SIGNIFICANCE Potentially Significant Impact Less Than Significant With Mitigation Less Than Significant Impact No Impact a) Does the project have the potential to substantially degrade the quality of the environment, substantially reduce the habitat of a fish or wildlife species, cause a fish or wildlife population to drop below self-sustaining levels, threaten to eliminate a plant or animal community, substantially reduce the number or restrict the range of a rare or endangered plant or animal or eliminate important examples of the major periods of California history or prehistory? ց b) Does the project have impacts that are individually limited, but cumulatively considerable? (“Cumulatively considerable” means that the incremental effects of a project are considerable when viewed in connection with the effects of past projects, the effects of other current projects, and the effects of probable future projects)? ց c) Does the project have environmental effects which will cause substantial adverse effects on human beings, either directly or indirectly? ց a) Environmental Quality. With the implementation of Mitigation Measures Bio-1 to protect nesting birds during construction and Cul-1 through Cul-3 to address the potential discovery of currently unknown cultural, tribal cultural, or paleontological resources at the site, the project would not degrade the quality of the environment, substantially reduce the habitat of a fish or wildlife species, cause a fish or wildlife population to drop below self-sustaining levels, or threaten to eliminate a plant or animal community. The project would not impact rare or endangered wildlife species or eliminate important examples of the major periods of California history or prehistory. b) Cumulative Impacts. The project would not result in adverse impacts that are individually limited but cumulatively considerable, including effects for which project-level mitigation were identified to reduce impacts to less than significant levels. All potential effects of the project were assessed in the context of area development, including assessment of emissions impacts analyzed against cumulative thresholds per the Air District recommendations. Project-specific impacts would be less than significant with implementation of mitigation measures identified in this document, including Mitigation Measure GP-MM-Air-1a to address construction period dust and emissions, and would not result in contribution of considerable levels to cumulative impacts. c) Adverse Effects on Human Beings. The project would not result in substantial adverse effects on human beings, either directly or indirectly. Mitigation Measures GP-MM-Air-1a, Air-2, Geo-1, and Haz-1 would minimize the potential for safety impacts related to construction-period emissions, disturbance of site contaminants, and appropriate techniques for safety during excavation and building construction. Therefore, the potential adverse effects on human beings would be less than significant with mitigation. Page 82 800 Dubuque Avenue Project Initial Study/MND DOCUMENT PREPARERS Lamphier -Gregory, Inc. (Primary Report Preparers) Rebecca Auld, Vice President Jenna Sunderlin, Environmental Planner 4100 Redwood Road, STE 20A - #601 Oakland, CA 94619 510-535-6690 Illingworth & Rodkin, Inc. (Air Quality and Greenhouse Gas Analysis) James A. Reyff, Principal Zachary Palm, Emissions Consultant 429 E. Cotati Ave Cotati, CA 94931 707-794-0400 Hexagon Transportation Consultants, Inc. (Transportation Analysis) Trisha Dudala, P.E. Senior Associate 5776 Stoneridge Mall Road, Suite 175 Pleasanton, CA 94588 925-225-1439 City of South San Francisco This document was prepared in coordination with City of South San Francisco staff, including Christopher Espiritu, Senior Planner. SOURCES 1. Association of Bay Area Governments and Metropolitan Transportation Commission, Plan Bay Area 2050 Final Blueprint Growth Pattern, January 2021. 2. BAWSCA, Water Reliability webpage, available at: https://bawsca.org/water/reliability 3. Bay Area Air Quality Management District, May 2017, California Environmental Quality Act Air Quality Guidelines. 4. Bay Area Air Quality Management District, June 2, 2010, News Release http://www.baaqmd.gov/~/media/Files/Communications%20and%20Outreach/Publications/News% 20Releases/2010/ceqa_100602.ashx 5. Bay Area Air Quality Management District. December 2021. Frequently Asked Questions for 2022 Permit Reform and Implementation of Regulation 2-1 and 2-5 Amendments. 6. Bay Area Air Quality Management District. December 15, 2021. Regulation 2 Permits Rule 1 General Requirements, Regulation 2-1-243 7. California Department of Forestry and Fire Protection, 2007, San Mateo County Fire Hazard Severity Zones in State Responsibility Areas, available at https://osfm.fire.ca.gov/divisions/wildfire-planning- engineering/wildland-hazards-building-codes/fire-hazard-severity-zones-maps/. 800 Dubuque Avenue Project Initial Study/MND Page 83 8. California Department of Forestry and Fire Protection Fire and Resource Assessment Program, November 24, 2008, San Mateo County Very High Fire Hazard Severity Zones in Local Responsibility Area, available at: https://osfm.fire.ca.gov/media/6800/fhszl_map41.pdf . 9. California Department of Resources Recycling and Recovery (CalRecycle), 2019, SWIS Facility Detail: Corinda Los Trancos Landfill (Ox Mtn) (41-AA-002), website accessed at https://www2.calrecycle.ca.gov/SolidWaste/SiteActivity/Details/1561?siteID=3223 10. California Department of Transportation, State Scenic Highway Mapping System, available at: https://dot.ca.gov/programs/design/lap-landscape-architecture-and-community-livability/lap-liv-i- scenic-highways 11. California Geological Survey, 2021, Tsunami Hazard Area Map, San Mateo County, available at: https://www.conservation.ca.gov/cgs/tsunami/maps. 12. California Regional Water Quality Control Board San Francisco Bay Region, San Francisco Bay Basin Water Quality Control Plan (Basin Plan), November 2019. 13. California Water Service (Cal Water), adopted June 2021, 2020 Urban Water Management Plan: South San Francisco District. 14. City/County Association of Governments of San Mateo County, November 2012, Comprehensive Airport Land Use Compatibility Plan for the Environs of San Francisco International Airport. 15. City of South San Francisco, 2022, ShapeSSF General Plan 2040. 16. Department of Toxic Substances Control EnviroStor Database, website accessed at http://www.envirostor.dtsc.ca.gov/public/ 17. Federal Emergency Management Agency (FEMA), April 2019, Flood Insurance Rate Map (FIRM), Map Number 06081C0042F. 18. FirstCarbon Solutions, June 24, 2022, Draft Program Environmental Impact Report General Plan Update, Zoning Code Amendments, and Climate Action Plan, City of South San Francisco, San Mateo County, California. 19. Langan Engineering and Environmental Services, July 9, 2021, Geotechnical Investigation. 20. Langan Engineering and Environmental Services, September 2, 2022, Draft Dewatering Assessment. 21. Langan Engineering and Environmental Services, July 15, 2022, Draft Soil and Groundwater Management Plan 22. Metropolitan Transportation Commission, 2021, Transit Priority Areas, accessed at: https://www.arcgis.com/home/item.html?id=370de9dc4d65402d992a769bf6ac8ef5 23. Ramboll US Consulting, Inc., January 2021, Phase I Environmental Site Assessment. 24. South San Francisco Scavenger Company, Inc. website, “About Us”, available at: https://ssfscavenger.com/about-us/. 25. State Water Resources Control Board GeoTracker Database, website accessed at http://geotracker.waterboards.ca.gov/ 26. University of California Museum of Paleontology (UCMP) Online Database. 2019. UCMP specimen search portal, http://ucmpdb.berkeley.edu/. 27. U.S. Geological Survey, Mineral Resources Data System: U.S. Geological Survey, website accessed at: http://tin.er.usgs.gov/mrds/ $,548$/,7<$1'*5((1+286(*$6$66(660(17 #66#%*/'06# WRWKH 'XEXTXH$YHQXH3URMHFW,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ '8%848($9(18( CONSTRUCTION AIR QUALITY AND GREENHOUSE GAS ASSESSMENT South San Francisco, California 1RYHPEHU 5HYLVHG0DUFK 3UHSDUHGIRU 5HEHFFD$XOG 9LFH3UHVLGHQW /DPSKLHU*UHJRU\ 5HGZRRG5G6XLWH$ 2DNODQG&$ 3UHSDUHGE\ =DFKDU\3DOP -DPHV$5H\II (DVW&RWDWL$YHQXH &RWDWL&$ , 53URMHFW ,QWURGXFWLRQ 7KHSXUSRVHRIWKLVUHSRUWLVWRDGGUHVVWKHSRWHQWLDOFRPPXQLW\ULVNLPSDFWVDVVRFLDWHGZLWKWKH FRQVWUXFWLRQRIWKHSURSRVHGUHVLGHQWLDOSURMHFWORFDWHGDW'XEXTXH$YHQXHLQ6RXWK6DQ )UDQFLVFR&DOLIRUQLD7KHDLUTXDOLW\LPSDFWVDQG*+*HPLVVLRQVZRXOGEHDVVRFLDWHGZLWKWKH GHPROLWLRQRIWKHH[LVWLQJXVHVDWWKHVLWHFRQVWUXFWLRQRIWKHQHZEXLOGLQJDQGLQIUDVWUXFWXUHDQG RSHUDWLRQRIWKHSURMHFW$LUSROOXWDQWHPLVVLRQVDVVRFLDWHGZLWKFRQVWUXFWLRQRIWKHSURMHFWZHUH SUHGLFWHGXVLQJDSSURSULDWHFRPSXWHUPRGHOV,QDGGLWLRQWKHSRWHQWLDOSURMHFWFRQVWUXFWLRQKHDOWK ULVNLPSDFWVDQGWKHLPSDFWRIH[LVWLQJWR[LFDLUFRQWDPLQDQW7$&VRXUFHVDIIHFWLQJWKHQHDUE\ DQGSURSRVHGVHQVLWLYHUHFHSWRUVZHUHHYDOXDWHG7KHDQDO\VLVZDVFRQGXFWHGIROORZLQJJXLGDQFH SURYLGHGE\WKH%D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW%$$40' 3URMHFW'HVFULSWLRQ 7KHDFUHSURMHFWVLWHLVFXUUHQWO\FRPSULVHGRIWZRRQHVWRU\EXLOGLQJVDQGRQHWZRVWRU\ EXLOGLQJWRWDOLQJVTXDUHIHHWVIRIRIILFH5 'OLIHVFLHQFHXVHDQGDVVRFLDWHGSDUNLQJ 7KHSURMHFWSURSRVHVWRGHPROLVKWKHH[LVWLQJEXLOGLQJVDQGSDUNLQJWRFRQVWUXFWWKUHHRIILFH5 ' OLIHVFLHQFHEXLOGLQJVWRWDOLQJXSWRVTXDUHIHHWVI)RXUOHYHOVRIVXEWHUUDQHDQSDUNLQJ DUHDOVRSODQQHGZKLFKZRXOGSURYLGHSDUNLQJVSDFHVRIZKLFKHOHFWULFYHKLFOH(9 SDUNLQJVSDFHVDUHSURSRVHGWREHFRQVWUXFWHGXSIURQWRIWRWDOZLWKDQDGGLWLRQDOVSDFHV (9UHDG\IRUIXWXUHRSHUDWLRQRIWRWDO7KLVLVFRQVLVWHQWZLWKWKHUHTXLUHPHQWVXQGHU 6HFWLRQRIWKH&LW\¶V0XQLFLSDO&RGHDQGWKH&DO*UHHQ7LHUUHTXLUHPHQWVDWWKHWLPH RISURMHFWDSSOLFDWLRQ)RUSXUSRVHVRIWKLVDQDO\VLVFRQVWUXFWLRQZDVDVVXPHGWREHJLQDVHDUO\DV $XJXVWDQGEHFRPSOHWHGE\0DUFK 6HWWLQJ 7KHSURMHFWLVORFDWHGLQ6DQ0DWHR&RXQW\ZKLFKLVLQWKH6DQ)UDQFLVFR%D\$UHD$LU%DVLQ $PELHQWDLUTXDOLW\VWDQGDUGVKDYHEHHQHVWDEOLVKHGDWERWKWKH6WDWHDQGIHGHUDOOHYHO7KH%D\ $UHDPHHWVDOODPELHQWDLUTXDOLW\VWDQGDUGVZLWKWKHH[FHSWLRQRIJURXQGOHYHOR]RQHUHVSLUDEOH SDUWLFXODWHPDWWHU30DQGILQHSDUWLFXODWHPDWWHU30 $LU3ROOXWDQWVRI&RQFHUQ +LJKR]RQHOHYHOVDUHFDXVHGE\WKHFXPXODWLYHHPLVVLRQVRIUHDFWLYHRUJDQLFJDVHV52*DQG QLWURJHQR[LGHV12[7KHVHSUHFXUVRUSROOXWDQWVUHDFWXQGHUFHUWDLQPHWHRURORJLFDOFRQGLWLRQV WRIRUPKLJKR]RQHOHYHOV&RQWUROOLQJWKHHPLVVLRQVRIWKHVHSUHFXUVRUSROOXWDQWVLVWKHIRFXVRI WKH%D\$UHD¶VDWWHPSWVWRUHGXFHR]RQHOHYHOV7KHKLJKHVWR]RQHOHYHOVLQWKH%D\$UHDRFFXULQ WKHHDVWHUQDQGVRXWKHUQLQODQGYDOOH\VWKDWDUHGRZQZLQGRIDLUSROOXWDQWVRXUFHV+LJKR]RQH OHYHOVDJJUDYDWHUHVSLUDWRU\DQGFDUGLRYDVFXODUGLVHDVHVUHGXFHGOXQJIXQFWLRQDQGLQFUHDVH FRXJKLQJDQGFKHVWGLVFRPIRUW 3DUWLFXODWHPDWWHULVDQRWKHUSUREOHPDWLFDLUSROOXWDQWRIWKH%D\$UHD3DUWLFXODWHPDWWHULV DVVHVVHGDQGPHDVXUHGLQWHUPVRIUHVSLUDEOHSDUWLFXODWHPDWWHURUSDUWLFOHVWKDWKDYHDGLDPHWHURI PLFURPHWHUVRUOHVV30DQGILQHSDUWLFXODWHPDWWHUZKHUHSDUWLFOHVKDYHDGLDPHWHURI %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFWCEQA Air Quality Guidelines0D\ PLFURPHWHUVRUOHVV30(OHYDWHGFRQFHQWUDWLRQVRI30DQG30DUHWKHUHVXOWRIERWK UHJLRQZLGHRUFXPXODWLYHHPLVVLRQVDQGORFDOL]HGHPLVVLRQV+LJKSDUWLFXODWHPDWWHUOHYHOV DJJUDYDWHUHVSLUDWRU\DQGFDUGLRYDVFXODUGLVHDVHVUHGXFHOXQJIXQFWLRQLQFUHDVHPRUWDOLW\HJ OXQJFDQFHUDQGUHVXOWLQUHGXFHGOXQJIXQFWLRQJURZWKLQFKLOGUHQ 7R[LF$LU&RQWDPLQDQWV 7R[LFDLUFRQWDPLQDQWV7$&DUHDEURDGFODVVRIFRPSRXQGVNQRZQWRFDXVHPRUELGLW\RU PRUWDOLW\XVXDOO\EHFDXVHWKH\FDXVHFDQFHUDQGLQFOXGHEXWDUHQRWOLPLWHGWRWKHFULWHULDDLU SROOXWDQWV7$&VDUHIRXQGLQDPELHQWDLUHVSHFLDOO\LQXUEDQDUHDVDQGDUHFDXVHGE\LQGXVWU\ DJULFXOWXUHIXHOFRPEXVWLRQDQGFRPPHUFLDORSHUDWLRQVHJGU\FOHDQHUV7$&VDUHW\SLFDOO\ IRXQGLQORZFRQFHQWUDWLRQVHYHQQHDUWKHLUVRXUFHHJGLHVHOSDUWLFXODWHPDWWHU>'30@QHDUD IUHHZD\%HFDXVHFKURQLFH[SRVXUHFDQUHVXOWLQDGYHUVHKHDOWKHIIHFWV7$&VDUHUHJXODWHGDWWKH UHJLRQDO6WDWHDQGIHGHUDOOHYHO 'LHVHOH[KDXVWLVWKHSUHGRPLQDQW7$&LQXUEDQDLUDQGLVHVWLPDWHGWRUHSUHVHQWDERXWWKUHH TXDUWHUV RI WKH FDQFHU ULVN IURP 7$&V EDVHG RQ WKH %D\ $UHD DYHUDJH $FFRUGLQJ WR WKH &DOLIRUQLD$LU5HVRXUFHV%RDUG&$5%GLHVHOH[KDXVWLVDFRPSOH[PL[WXUHRIJDVHVYDSRUV DQGILQHSDUWLFOHV7KLVFRPSOH[LW\PDNHVWKHHYDOXDWLRQRIKHDOWKHIIHFWVRIGLHVHOH[KDXVWD FRPSOH[ VFLHQWLILF LVVXH 6RPH RI WKH FKHPLFDOV LQ GLHVHO H[KDXVW VXFK DV EHQ]HQH DQG IRUPDOGHK\GH KDYH EHHQ SUHYLRXVO\ LGHQWLILHG DV 7$&V E\ WKH &$5% DQG DUH OLVWHG DV FDUFLQRJHQVHLWKHUXQGHUWKH6WDWH V3URSRVLWLRQRUXQGHUWKH)HGHUDO+D]DUGRXV$LU3ROOXWDQWV SURJUDPV7KHPRVWUHFHQW2IILFHRI(QYLURQPHQWDO+HDOWK+D]DUG$VVHVVPHQW2(++$ULVN DVVHVVPHQWJXLGHOLQHVZHUHSXEOLVKHGLQ)HEUXDU\RI6HHAttachment 1IRUDGHWDLOHG GHVFULSWLRQRIWKHFRPPXQLW\ULVNPRGHOLQJPHWKRGRORJ\XVHGLQWKLVDVVHVVPHQW 6HQVLWLYH5HFHSWRUV 7KHUHDUHJURXSVRISHRSOHPRUHDIIHFWHGE\DLUSROOXWLRQWKDQRWKHUV&$5%KDVLGHQWLILHGWKH IROORZLQJSHUVRQVZKRDUHPRVWOLNHO\WREHDIIHFWHGE\DLUSROOXWLRQFKLOGUHQXQGHUWKHHOGHUO\ RYHUDWKOHWHVDQGSHRSOHZLWKFDUGLRYDVFXODUDQGFKURQLFUHVSLUDWRU\GLVHDVHV7KHVHJURXSV DUHFODVVLILHGDVVHQVLWLYHUHFHSWRUV/RFDWLRQVWKDWPD\FRQWDLQDKLJKFRQFHQWUDWLRQRIWKHVH VHQVLWLYH SRSXODWLRQ JURXSV LQFOXGH UHVLGHQWLDO DUHDV KRVSLWDOV GD\FDUH IDFLOLWLHV HOGHU FDUH IDFLOLWLHVDQGHOHPHQWDU\VFKRROV)RUFDQFHUULVNDVVHVVPHQWVFKLOGUHQDUHWKHPRVWVHQVLWLYH UHFHSWRUVVLQFHWKH\DUHPRUHVXVFHSWLEOHWRFDQFHUFDXVLQJ7$&V5HVLGHQWLDOORFDWLRQVDUH DVVXPHGWRLQFOXGHLQIDQWVDQGVPDOOFKLOGUHQ7KHFORVHVWVHQVLWLYHUHFHSWRUVWRWKHSURMHFWVLWH DUHLQWKHPXOWLIDPLO\UHVLGHQFHVWRWKHZHVWRIWKHSURMHFWVLWH7KHUHDUHPRUHUHFHSWRUVDWIXUWKHU GLVWDQFHVLQFOXGLQJFKLOGUHQDWWKH*DWHZD\&KLOG'HYHORSPHQW&HQWHU<0&$DSSUR[LPDWHO\ IHHWVRXWKHDVWRIWKHSURMHFWVLWH7KLVSURMHFWZRXOGQRWLQWURGXFHQHZVHQVLWLYHUHFHSWRUVLH UHVLGHQWVWRWKHDUHD 2(++$Air Toxics Hot Spots Program Risk Assessment Guidelines, The Air Toxics Hot Spots Program Guidance Manual for Preparation of Health Risk Assessments2IILFHRI(QYLURQPHQWDO+HDOWK+D]DUG$VVHVVPHQW )HEUXDU\ 5HJXODWRU\6HWWLQJ )HGHUDO5HJXODWLRQV 7KH8QLWHG6WDWHV(QYLURQPHQWDO3URWHFWLRQ$JHQF\(3$VHWVQDWLRQZLGHHPLVVLRQVWDQGDUGV IRUPRELOHVRXUFHVZKLFKLQFOXGHRQURDGKLJKZD\PRWRUYHKLFOHVVXFKWUXFNVEXVHVDQG DXWRPRELOHVDQGQRQURDGRIIURDGYHKLFOHVDQGHTXLSPHQWXVHGLQFRQVWUXFWLRQDJULFXOWXUDO LQGXVWULDODQGPLQLQJDFWLYLWLHVVXFKDVEXOOGR]HUVDQGORDGHUV7KH(3$DOVRVHWVQDWLRQZLGH IXHOVWDQGDUGV&DOLIRUQLDDOVRKDVWKHDELOLW\WRVHWPRWRUYHKLFOHHPLVVLRQVWDQGDUGVDQGVWDQGDUGV IRUIXHOXVHGLQ&DOLIRUQLDDVORQJDVWKH\DUHWKHVDPHRUPRUHVWULQJHQWWKDQWKHIHGHUDOVWDQGDUGV ,QWKHSDVWGHFDGHWKH(3$KDVHVWDEOLVKHGDQXPEHURIHPLVVLRQVWDQGDUGVIRURQDQGQRQURDG KHDY\GXW\GLHVHOHQJLQHVXVHGLQWUXFNVDQGRWKHUHTXLSPHQW7KLVZDVGRQHLQSDUWEHFDXVHGLHVHO HQJLQHVDUHDVLJQLILFDQWVRXUFHRI12;DQGSDUWLFXODWHPDWWHU30DQG30DQGEHFDXVHWKH (3$KDVLGHQWLILHG'30DVDSUREDEOHFDUFLQRJHQ,PSOHPHQWDWLRQRIWKHKHDY\GXW\GLHVHORQ URDGYHKLFOHVWDQGDUGVDQGWKHQRQURDGGLHVHOHQJLQHVWDQGDUGVDUHHVWLPDWHGWRUHGXFHSDUWLFXODWH PDWWHUDQG12;HPLVVLRQVIURPGLHVHOHQJLQHVXSWRSHUFHQWLQZKHQWKHKHDY\GXW\ YHKLFOH IOHHW LV FRPSOHWHO\ UHSODFHG ZLWK QHZHU KHDY\GXW\ YHKLFOHV WKDW FRPSO\ ZLWK WKHVH HPLVVLRQVWDQGDUGV ,QFRQFHUWZLWKWKHGLHVHOHQJLQHHPLVVLRQVWDQGDUGVWKH(3$KDVDOVRVXEVWDQWLDOO\UHGXFHGWKH DPRXQWRIVXOIXUDOORZHGLQGLHVHOIXHOV7KHVXOIXUFRQWDLQHGLQGLHVHOIXHOLVDVLJQLILFDQW FRQWULEXWRU WR WKH IRUPDWLRQ RI SDUWLFXODWH PDWWHU LQ GLHVHOIXHOHG HQJLQH H[KDXVW 7KH QHZ VWDQGDUGVUHGXFHGWKHDPRXQWRIVXOIXUDOORZHGE\SHUFHQWIRUKLJKZD\GLHVHOIXHOIURP SDUWVSHUPLOOLRQE\ZHLJKW>SSPZ@WRSSPZDQGE\SHUFHQWIRURIIKLJKZD\GLHVHOIXHO IURPDERXWSSPZWRSSPZ7KHORZVXOIXUKLJKZD\IXHOSSPZVXOIXUDOVRFDOOHG XOWUDORZVXOIXUGLHVHO8/6'LVFXUUHQWO\UHTXLUHGIRUXVHE\DOOYHKLFOHVLQWKH86 $OO RI WKH DERYH IHGHUDO GLHVHO HQJLQH DQG GLHVHO IXHO UHTXLUHPHQWV KDYH EHHQ DGRSWHG E\ &DOLIRUQLDLQVRPHFDVHVZLWKPRGLILFDWLRQVPDNLQJWKHUHTXLUHPHQWVPRUHVWULQJHQWRUWKH LPSOHPHQWDWLRQGDWHVVRRQHU 6WDWH5HJXODWLRQV 7RDGGUHVVWKHLVVXHRIGLHVHOHPLVVLRQVLQWKHVWDWH&$5%GHYHORSHGWKH5LVN5HGXFWLRQ3ODQWR 5HGXFH3DUWLFXODWH0DWWHU(PLVVLRQVIURP'LHVHO)XHOHG(QJLQHVDQG9HKLFOHV,QDGGLWLRQWR UHTXLULQJPRUHVWULQJHQWHPLVVLRQVWDQGDUGVIRUQHZRQURDGDQGRIIURDGPRELOHVRXUFHVDQG VWDWLRQDU\GLHVHOIXHOHGHQJLQHVWRUHGXFHSDUWLFXODWHPDWWHUHPLVVLRQVE\SHUFHQWDVLJQLILFDQW FRPSRQHQW RI WKH SODQ LQYROYHV DSSOLFDWLRQ RI HPLVVLRQ FRQWUROVWUDWHJLHV WR H[LVWLQJ GLHVHO YHKLFOHVDQGHTXLSPHQW0DQ\RIWKHPHDVXUHVRIWKH'LHVHO5LVN5HGXFWLRQ3ODQKDYHEHHQ DSSURYHG DQG DGRSWHG LQFOXGLQJ WKH IHGHUDO RQURDG DQG QRQURDG GLHVHO HQJLQH HPLVVLRQ VWDQGDUGVIRUQHZHQJLQHVDVZHOODVDGRSWLRQRIUHJXODWLRQVIRUORZVXOIXUIXHOLQ&DOLIRUQLD 86(3$Regulatory Announcement, Heavy-Duty Engine and Vehicle Standards and Highway Diesel Fuel Sulfur Control Requirements(3$)'HFHPEHU &DOLIRUQLD$LU5HVRXUFHV%RDUG5LVN5HGXFWLRQ3ODQWR5HGXFH3DUWLFXODWH0DWWHU(PLVVLRQVIURP'LHVHO )XHOHG(QJLQHVDQG9HKLFOHV2FWREHU &$5%KDVDGRSWHGDQGLPSOHPHQWHGDQXPEHURIUHJXODWLRQVIRUVWDWLRQDU\DQGPRELOHVRXUFHVWR UHGXFHHPLVVLRQVRI'306HYHUDORIWKHVHUHJXODWRU\SURJUDPVDIIHFWPHGLXPDQGKHDY\GXW\ GLHVHO WUXFNV WKDW UHSUHVHQW WKH EXON RI '30 HPLVVLRQV IURP &DOLIRUQLD KLJKZD\V &$5% UHJXODWLRQVUHTXLUH RQURDG GLHVHO WUXFNVWR EH UHWURILWWHGZLWK SDUWLFXODWH PDWWHU FRQWUROV RU UHSODFHGWRPHHWRUODWHUHQJLQHVWDQGDUGVWKDWKDYHPXFKORZHU'30DQG30HPLVVLRQV 7KLVUHJXODWLRQZLOOVXEVWDQWLDOO\UHGXFHWKHVHHPLVVLRQVEHWZHHQDQG:KLOHQHZ WUXFNVDQGEXVHVZLOOPHHWVWULFWIHGHUDOVWDQGDUGVWKLVPHDVXUHLVLQWHQGHGWRDFFHOHUDWHWKHUDWH DWZKLFKWKHIOHHWHLWKHUWXUQVRYHUVRWKHUHDUHPRUHFOHDQHUYHKLFOHVRQWKHURDGRULVUHWURILWWHG WRPHHWVLPLODUVWDQGDUGV:LWKWKLVUHJXODWLRQROGHUPRUHSROOXWLQJWUXFNVZRXOGEHUHPRYHG IURPWKHURDGVVRRQHU &$5%KDVDOVRDGRSWHGDQGLPSOHPHQWHGUHJXODWLRQVWRUHGXFH'30DQG12;HPLVVLRQVIURPLQ XVHH[LVWLQJDQGQHZRIIURDGKHDY\GXW\GLHVHOYHKLFOHVHJORDGHUVWUDFWRUVEXOOGR]HUV EDFNKRHVRIIKLJKZD\WUXFNVHWF7KHUHJXODWLRQVDSSO\WRGLHVHOSRZHUHGRIIURDGYHKLFOHV ZLWKHQJLQHVKRUVHSRZHUKSRUJUHDWHU7KHUHJXODWLRQVDUHLQWHQGHGWRUHGXFHSDUWLFXODWH PDWWHUDQG12;H[KDXVWHPLVVLRQVE\UHTXLULQJRZQHUVWRWXUQRYHUWKHLUIOHHWUHSODFHROGHU HTXLSPHQWZLWKQHZHUHTXLSPHQWRUUHWURILWH[LVWLQJHTXLSPHQWLQRUGHUWRDFKLHYHVSHFLILHGIOHHW DYHUDJHGHPLVVLRQUDWHV,PSOHPHQWDWLRQRIWKLVUHJXODWLRQLQFRQMXQFWLRQZLWKVWULQJHQWIHGHUDO RIIURDGHTXLSPHQWHQJLQHHPLVVLRQOLPLWVIRUQHZYHKLFOHVZLOOVLJQLILFDQWO\UHGXFHHPLVVLRQVRI '30DQG12; %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW%$$40' %$$40'KDVMXULVGLFWLRQRYHUDQDSSUR[LPDWHO\VTXDUHPLOHDUHDFRPPRQO\UHIHUUHGWR DVWKH6DQ)UDQFLVFR%D\$UHD%D\$UHD7KH'LVWULFW¶VERXQGDU\HQFRPSDVVHVWKHQLQH6DQ )UDQFLVFR%D\$UHDFRXQWLHVLQFOXGLQJ$ODPHGD&RXQW\&RQWUD&RVWD&RXQW\0DULQ&RXQW\ 6DQ )UDQFLVFR &RXQW\ 6DQ 0DWHR&RXQW\ 6DQWD &ODUD &RXQW\ 1DSD &RXQW\ VRXWKZHVWHUQ 6RODQR&RXQW\DQGVRXWKHUQ6RQRPD&RXQW\ %$$40'LVWKHOHDGDJHQF\LQGHYHORSLQJSODQVWRDGGUHVVDWWDLQPHQWDQGPDLQWHQDQFHRIWKH 1DWLRQDO$PELHQW$LU4XDOLW\6WDQGDUGVDQG&DOLIRUQLD$PELHQW$LU4XDOLW\6WDQGDUGV7KH 'LVWULFWDOVRKDVSHUPLWDXWKRULW\RYHUPRVWW\SHVRIVWDWLRQDU\HTXLSPHQWXWLOL]HGIRUWKHSURSRVHG SURMHFW 7KH %$$40' LV UHVSRQVLEOH IRU SHUPLWWLQJ DQG LQVSHFWLRQ RI VWDWLRQDU\ VRXUFHV HQIRUFHPHQWRIUHJXODWLRQVLQFOXGLQJVHWWLQJIHHVOHY\LQJILQHVDQGHQIRUFHPHQWDFWLRQVDQG HQVXULQJWKDWSXEOLFQXLVDQFHVDUHPLQLPL]HG %$$40'¶V&RPPXQLW\$LU5LVN(YDOXDWLRQ&$5(SURJUDPZDVLQLWLDWHGLQWRHYDOXDWH DQGUHGXFHKHDOWKULVNVDVVRFLDWHGZLWKH[SRVXUHVWRRXWGRRU7$&VLQWKH%D\$UHD7KHSURJUDP H[DPLQHV7$&HPLVVLRQVIURPSRLQWVRXUFHVDUHDVRXUFHVDQGRQURDGDQGRIIURDGPRELOH VRXUFHVZLWKDQHPSKDVLVRQGLHVHOH[KDXVWZKLFKLVDPDMRUFRQWULEXWRUWRDLUERUQHKHDOWKULVNLQ &DOLIRUQLD7KH&$5(SURJUDPLVDQRQJRLQJSURJUDPWKDWHQFRXUDJHVFRPPXQLW\LQYROYHPHQW DQGLQSXW7KHWHFKQLFDODQDO\VLVSRUWLRQRIWKH&$5(SURJUDPLVEHLQJLPSOHPHQWHGLQWKUHH SKDVHVWKDWLQFOXGHVDQDVVHVVPHQWRIWKHVRXUFHVRI7$&HPLVVLRQVPRGHOLQJDQGPHDVXUHPHQW 6HH%$$40'KWWSVZZZEDDTPGJRYFRPPXQLW\KHDOWKFRPPXQLW\KHDOWKSURWHFWLRQSURJUDPFRPPXQLW\ DLUULVNHYDOXDWLRQFDUHSURJUDPDFFHVVHG SURJUDPVWRHVWLPDWHFRQFHQWUDWLRQVRI7$&DQGDQDVVHVVPHQWRIH[SRVXUHVDQGKHDOWKULVNV 7KURXJKRXWWKHSURJUDPLQIRUPDWLRQGHULYHGIURPWKHWHFKQLFDODQDO\VHVZLOOEHXVHGWRIRFXV HPLVVLRQUHGXFWLRQPHDVXUHVLQDUHDVZLWKKLJK7$&H[SRVXUHVDQGKLJKGHQVLW\RIVHQVLWLYH SRSXODWLRQV5LVNUHGXFWLRQDFWLYLWLHVDVVRFLDWHGZLWKWKH&$5(SURJUDPDUHIRFXVHGRQWKHPRVW DWULVNFRPPXQLWLHVLQWKH%D\$UHD2YHUEXUGHQHGFRPPXQLWLHVDUHDUHDVORFDWHGLZLWKLQD FHQVXV WUDFW LGHQWLILHGE\ WKH &DOLIRUQLD &RPPXQLWLHV (QYLURQPHQWDO +HDOWK 6FUHHQLQJ 7RRO &DO(QYLUR6FUHHQ9HUVLRQLPSOHPHQWHGE\2(++$DVKDYLQJDQRYHUDOO&DO(QYLUR6FUHHQ VFRUHDWRUDERYHWKHWKSHUFHQWLOHRULLZLWKLQIHHWRIDQ\VXFKFHQVXVWUDFW7KH %$$40'KDVLGHQWLILHGVL[FRPPXQLWLHVDVLPSDFWHG&RQFRUG5LFKPRQG6DQ3DEOR:HVWHUQ $ODPHGD&RXQW\6DQ-RVp5HGZRRG&LW\(DVW3DOR$OWRDQG(DVWHUQ6DQ)UDQFLVFR7KHSURMHFW VLWHLVORFDWHGZLWKLQD%$$40'RYHUEXUGHQHGDUHDDVWKH3URMHFWVLWHLVVFRUHGDWWKHUG SHUFHQWLOHDVLGHQWLILHGE\&DO(QYLUR6FUHHQGXHWRKLJKH[SRVXUHWRGLHVHOSDUWLFXODWHPDWWHU '30DQGWUDIILFEXWLWLVQRWZLWKLQD&$5(DUHD 7KH%$$40'&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FWCEQA) Air Quality GuidelinesZHUH SUHSDUHGWRDVVLVWLQWKHHYDOXDWLRQRIDLUTXDOLW\LPSDFWVRISURMHFWVDQGSODQVSURSRVHGZLWKLQWKH %D\$UHD7KHJXLGHOLQHVSURYLGHUHFRPPHQGHGSURFHGXUHVIRUHYDOXDWLQJSRWHQWLDODLULPSDFWV GXULQJWKHHQYLURQPHQWDOUHYLHZSURFHVVFRQVLVWHQWZLWK&(4$UHTXLUHPHQWVLQFOXGLQJWKUHVKROGV RIVLJQLILFDQFHPLWLJDWLRQPHDVXUHVDQGEDFNJURXQGDLUTXDOLW\LQIRUPDWLRQ7KH\DOVRLQFOXGH DVVHVVPHQWPHWKRGRORJLHVIRUDLUWR[LFVRGRUVDQGJUHHQKRXVHJDVHPLVVLRQVAttachment 1 LQFOXGHVGHWDLOHGFRPPXQLW\ULVNPRGHOLQJPHWKRGRORJ\ %$$40'5XOHVDQG5HJXODWLRQV &RPEXVWLRQHTXLSPHQWDVVRFLDWHGZLWKWKHSURSRVHGSURMHFWWKDWLQFOXGHVQHZGLHVHOHQJLQHVWR SRZHU JHQHUDWRUV ZRXOG HVWDEOLVK QHZ VRXUFHV RI SDUWLFXODWH PDWWHU DQG JDVHRXV HPLVVLRQV (PLVVLRQVZRXOGSULPDULO\UHVXOWIURPWKHWHVWLQJRIWKHHPHUJHQF\EDFNXSJHQHUDWRUV&HUWDLQ HPLVVLRQVRXUFHVZRXOGEHVXEMHFWWR%$$40'5HJXODWLRQVDQG5XOHV7KH'LVWULFW¶VUXOHVDQG UHJXODWLRQVWKDWPD\DSSO\WRWKHSURMHFWLQFOXGH x5HJXODWLRQ±3HUPLWV 5XOH*HQHUDO5HTXLUHPHQWV 5XOH1HZ6RXUFH5HYLHZ x5HJXODWLRQ±3DUWLFXODWH0DWWHUDQG9LVLEOH(PLVVLRQV 5XOH:RRG%XUQLQJ'HYLFHV x5HJXODWLRQ±,QRUJDQLF*DVHRXV3ROOXWDQWV 5XOH6XOIXU'LR[LGH 5XOH1LWURJHQ2[LGHVDQG&DUERQ0RQR[LGHIURP,QGXVWULDO,QVWLWXWLRQDODQG &RPPHUFLDO%RLOHUV6WHDP*HQHUDWRUV$QG3URFHVV+HDWHUV 5XOH 1LWURJHQ 2[LGHV DQG &DUERQ 0RQR[LGH IURP 6WDWLRQDU\ ,QWHUQDO &RPEXVWLRQ(QJLQHV 6HH%$$40'KWWSVZZZEDDTPGJRYaPHGLDGRWJRYILOHVUXOHVUHJSHUPLWV DPHQGPHQWVGRFXPHQWVBBDSSHQGL[GBPDSVRIRYHUEXUGHQHGFRPPXQLWLHVSGISGI"OD HQDFFHVVHG 2(+$$&DO(QYLUR6FUHHQ,QGLFDWRU0DSVKWWSVRHKKDFDJRYFDOHQYLURVFUHHQUHSRUWFDOHQYLURVFUHHQ %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFWCEQA Air Quality Guidelines0D\ Permits 5XOHUHTXLUHVWKDWDQ\SHUVRQLQVWDOOLQJPRGLI\LQJRUUHSODFLQJDQ\HTXLSPHQWWKHXVH RIZKLFKPD\UHGXFHRUFRQWUROWKHHPLVVLRQRIDLUFRQWDPLQDQWVVKDOOILUVWREWDLQDQ$XWKRULW\WR &RQVWUXFW$7& 5XOHUHTXLUHVWKDWZULWWHQDXWKRUL]DWLRQIURPWKH%$$40'LQWKHIRUPRID3HUPLWWR 2SHUDWH372EHVHFXUHGEHIRUHDQ\VXFKHTXLSPHQWLVXVHGRURSHUDWHG 5XOHOLVWVVRXUFHVWKDWDUHH[HPSWIURPSHUPLWWLQJ New Source Review 5XOH1HZ6RXUFH5HYLHZ165DSSOLHVWRDOOQHZDQGPRGLILHGVRXUFHVRUIDFLOLWLHVWKDWDUH VXEMHFWWRWKHUHTXLUHPHQWVRI5XOH7KHSXUSRVHRIWKHUXOHLVWRSURYLGHIRUUHYLHZRI VXFKVRXUFHVDQGWRSURYLGHPHFKDQLVPVE\ZKLFKQRQHWLQFUHDVHLQHPLVVLRQVZLOOUHVXOW 5XOH UHTXLUHV WKDW DQ DSSOLFDQW IRU DQ $7& RU 372 DSSO\ %HVW $YDLODEOH &RQWURO 7HFKQRORJ\%$&7WRDQ\QHZRUPRGLILHGVRXUFHWKDWUHVXOWVLQDQLQFUHDVHLQHPLVVLRQVDQG KDVHPLVVLRQVRISUHFXUVRURUJDQLFFRPSRXQGVQRQSUHFXUVRURUJDQLFFRPSRXQGV12[62 30RU&2RISRXQGVRUPRUHSHUKLJKHVWGD\%DVHGRQWKHHVWLPDWHGHPLVVLRQVIURPWKH SURSRVHGSURMHFW%$&7ZLOOEHUHTXLUHGIRU12[HPLVVLRQVIURPWKHGLHVHOIXHOHGJHQHUDWRU HQJLQHV Stationary Diesel Airborne Toxic Control Measure 7KH%$$40'DGPLQLVWHUVWKH&$5%¶V$LUERUQH7R[LF&RQWURO0HDVXUH$&70IRU6WDWLRQDU\ 'LHVHOHQJLQHVVHFWLRQWLWOH&$&RGHRI5HJXODWLRQV7KHSURMHFW¶VVWDWLRQDU\VRXUFHV ZLOOEHQHZVWDWLRQDU\HPHUJHQF\VWDWLRQDU\HPHUJHQF\VWDQGE\GLHVHOHQJLQHVODUJHUWKDQKS 7KHVHOLPLWVYDU\EDVHGRQPD[LPXPHQJLQHSRZHU$OOHQJLQHVDUHOLPLWHGWR30HPLVVLRQUDWHV RIJKSKRXUUHJDUGOHVVRIVL]H7KLV$&70OLPLWVHQJLQHRSHUDWLRQKRXUVSHU\HDUIRU URXWLQHWHVWLQJDQGPDLQWHQDQFH Offsets 5XOHUHTXLUHWKDWRIIVHWVEHSURYLGHGIRUDQHZRUPRGLILHGVRXUFHWKDWHPLWVPRUHWKDQ WRQVSHU\HDURI12[RUSUHFXUVRURUJDQLFFRPSRXQGV Prohibitory Rules 5HJXODWLRQSHUWDLQVWRSDUWLFXODWHPDWWHUDQGYLVLEOHHPLVVLRQV$OWKRXJKWKHHQJLQHVZLOOEH IXHOHGZLWKGLHVHOWKH\ZLOOEHPRGHUQORZHPLVVLRQHQJLQHV7KXVWKHHQJLQHVDUHH[SHFWHGWR FRPSO\ZLWK5HJXODWLRQ 5XOHDSSOLHVWRHPLVVLRQVIURPZRRGEXUQLQJGHYLFHV(IIHFWLYH1RYHPEHUQRSHUVRQ RUEXLOGHUVKDOOLQVWDOODZRRGEXUQLQJGHYLFHLQDQHZEXLOGLQJFRQVWUXFWLRQ 5XOHDSSOLHVWRVXOIXUGLR[LGH7KHHQJLQHVZLOOXVHXOWUDORZVXOIXUGLHVHOIXHOOHVVWKDQ SSPVXOIXUDQGZLOOQRWEHDVLJQLILFDQWVRXUFHRIVXOIXUGLR[LGHHPLVVLRQVDQGDUHH[SHFWHGWR FRPSO\ZLWKWKHUHTXLUHPHQWVRI5XOH 5XOHOLPLWVWKHHPLVVLRQVRI12[&2IURPLQGXVWULDOLQVWLWXWLRQDODQGFRPPHUFLDOERLOHUV VWHDPJHQHUDWRUVDQGSURFHVVKHDWHUV7KLVUHJXODWLRQW\SLFDOO\DSSOLHVWRERLOHUVZLWKDKHDWUDWLQJ RIPLOOLRQ%ULWLVK7KHUPDO8QLWV%78SHUKRXU 5XOHSUHVFULEHV12[DQG&2HPLVVLRQOLPLWVIRUVWDWLRQDU\LQWHUQDOFRPEXVWLRQHQJLQHV6LQFH WKH SURSRVHG HQJLQHV ZLOO EH XVHG ZLWK HPHUJHQF\ VWDQGE\ JHQHUDWRUV 5HJXODWLRQ H[HPSWVWKHHQJLQHVIURPWKHUHTXLUHPHQWVRIWKLV5XOHH[FHSWIRUWKHUHFRUGNHHSLQJUHTXLUHPHQWV DQGOLPLWDWLRQVRQKRXUVRIRSHUDWLRQIRUUHOLDELOLW\UHODWHGRSHUDWLRQPDLQWHQDQFHDQG WHVWLQJ 7KH HQJLQHV ZLOO QRW RSHUDWH PRUH WKDQ KRXUV SHU \HDU ZKLFK ZLOO VDWLVI\ WKH UHTXLUHPHQWVRI BACT for Diesel Generator Engines 6LQFHWKHJHQHUDWRUVZLOOEHXVHGH[FOXVLYHO\IRUHPHUJHQF\XVHGXULQJLQYROXQWDU\ORVVRISRZHU WKH%$&7OHYHOVOLVWHGIRU,&FRPSUHVVLRQHQJLQHVLQWKH%$$40'%$&7*XLGHOLQHVZRXOG DSSO\7KHVHDUHSURYLGHGIRUWZRVHSDUDWHVL]HUDQJHVRIGLHVHOHQJLQHV ,&(QJLQH±&RPSUHVVLRQ,JQLWLRQ!KSDQGKS%$$40'DSSOLHV%$&7 HPLVVLRQOLPLWVEDVHGRQWKH$7&0IRUVWDWLRQDU\HPHUJHQF\VWDQGE\GLHVHOHQJLQHVODUJHU WKDQEUDNHKRUVHSRZHU%+312[HPLVVLRQIDFWRUOLPLWLVVXEMHFWWRWKH&$5% $&70WKDWUDQJHVIURPWRJUDPVSHUKRUVHSRZHUKRXUJKSKU7KH3030 RU30OLPLWLVJKSKUSHU&$5%¶V$&70 ,&(QJLQH±&RPSUHVVLRQ,JQLWLRQKS%$$40'DSSOLHVVSHFLILF%$&7HPLVVLRQ OLPLWVIRUVWDWLRQDU\HPHUJHQF\VWDQGE\GLHVHOHQJLQHVHTXDORUODUJHUWKDQEUDNH KRUVHSRZHU%+312[HPLVVLRQIDFWRUOLPLWLVVXEMHFWWRWKH&$5%$&70WKDWUDQJHV IURPJKSKU7KH3030RU30OLPLWLVJKSKU32&LH52*OLPLWV DUHJKSKU &LW\RI6RXWK6DQ)UDQFLVFR*HQHUDO3ODQ $GRSWHGLQ2FWREHUWKH&LW\RI6RXWK6DQ)UDQFLVFR*HQHUDO3ODQLQFOXGHVJXLGLQJ DQGLPSOHPHQWLQJSROLFLHVWRUHGXFHH[SRVXUHRIWKH&LW\¶VVHQVLWLYHSRSXODWLRQWRH[SRVXUHRIDLU SROOXWLRQWR[LFDLUFRQWDPLQDQWVDQGJUHHQKRXVHJDVHV,WLQFOXGHVDJRDORIUHDFKLQJFDUERQ QHXWUDOLW\E\DQGKDVVHWDWDUJHWRIDUHGXFWLRQLQFRPPXQLW\ZLGHHPLVVLRQVE\ 7KHIROORZLQJJRDOVDQGSROLFLHVDUHDSSOLFDEOHWRWKHSURSRVHGSURMHFW &LW\RI6RXWK6DQ)UDQFLVFR85/KWWSVVKDSHVVIFRPZS FRQWHQWXSORDGV66)*38B3')3ODQB)LQDO3ODQB5HVROXWLRQSGI *HQHUDO3ODQ$LU4XDOLW\3ROLFLHV Sub-Areas Element SA-28.5 5HTXLUH VXVWDLQDEOH DQG HQYLURQPHQWDOO\ VHQVLWLYH GHVLJQ ,QFRUSRUDWH VXVWDLQDEOH DQG HQYLURQPHQWDOO\ VHQVLWLYH GHVLJQ DQG HTXLSPHQWHQHUJ\ FRQVHUYDWLRQ IHDWXUHV ZDWHU FRQVHUYDWLRQ PHDVXUHV DQG GURXJKWWROHUDQW RU HTXLYDOHQWODQGVFDSLQJDQGVXVWDLQDEOHVWRUPZDWHUPDQDJHPHQWIHDWXUHV SA-32.5&UHDWHEXIIHULQJIURP86&UHDWHODQGVFDSLQJEXIIHUVDQGRWKHUEXIIHUVWR UHGXFHQRLVHYLVXDODQGDLUTXDOLW\LPSDFWVIURP86$3URVSHURXVHFRQRP\ IRU$OO(OHPHQW A Prosperous Economy for All Element PE-2.15HLQYHVWLQLQGXVWULDOSURSHUW\:LWKLQDUHDVWDUJHWHGIRUUHWHQWLRQRILQGXVWULDO XVHVVXSSRUWLQGXVWULDOSURSHUW\RZQHUVVHHNLQJWRUHLQYHVWLQDQGPRGHUQL]H WKHLUSURSHUWLHVDQGFRPHLQWRFRPSOLDQFHZLWKHQYLURQPHQWDOUHJXODWLRQVFXUUHQW EXLOGLQJFRGHVDQGXVHSURGXFWLRQRIJUHHQHQHUJ\ Community Health and Environmental Justice &+(-6XSSRUWUHJLRQDOHIIRUWVWRLPSURYHDLUTXDOLW\DQGSURWHFWKXPDQKHDOWK Action CHEJ-3.1.10RQLWRUDLUTXDOLW\LQ/LQGHQYLOOH(DVWRIDQGGRZQWRZQ :RUNZLWKWKH%D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFWWRHVWDEOLVKDQG LGHQWLI\IXQGLQJIRUDLUTXDOLW\PRQLWRULQJDQGUHGXFWLRQVWUDWHJLHV7KLV DFWLRQPD\LQFOXGHSXUFKDVLQJSDUWLFXODWHPDWWHU30PRQLWRUVWR WUDFNORFDODLUTXDOLW\GDWDLQ/LQGHQYLOOH(DVWRIDQG'RZQWRZQ CHEJ-3.25HGXFHPRELOHVRXUFHSROOXWLRQ5HGXFHHPLVVLRQVIURPPRELOHVRXUFHVRIDLU SROOXWLRQVXFKDVGLHVHOEDVHGWUXFNVDQGYHKLFOHVWKDWWUDYHOWRIURPRUWKURXJK 6RXWK6DQ)UDQFLVFR CHEJ-3.36XSSRUWEXVLQHVVHVWUDQVLWLRQLQJWKHLURSHUDWLRQVWRHPLWIHZHUDLU SROOXWDQWV6XSSRUWORFDOEXVLQHVVRZQHUVLQWUDQVLWLRQLQJWKHLURSHUDWLRQVWRHPLW IHZHUDLUSROOXWDQWVWKURXJKLQFHQWLYHVDQGGHYHORSPHQWVWDQGDUGV Action CHEJ-3.3.1 ([SORUHLQFHQWLYHVIRUSROOXWLRQUHGXFWLRQ([SORUH RSSRUWXQLWLHVIRUSURGXFWLRQGLVWULEXWLRQDQGZDUHKRXVLQJXVHVLQ /LQGHQYLOOHDQG(DVWRIWRUHGXFHSROOXWLRQVXFKDVJUHHQHUWUXFNV HQHUJ\HIILFLHQWEXLOGLQJVDQGRWKHUVWUDWHJLHV Action CHEJ-3.3.2 5HGXFHLQGRRUDLUSROOXWLRQ([SORUHRSSRUWXQLWLHVWRZRUN ZLWKSURSHUW\RZQHUVWRUHKDELOLWDWHH[LVWLQJEXLOGLQJVDQGUHTXLUHWKDWQHZ EXLOGLQJV DGMDFHQW WR SURGXFWLRQ GLVWULEXWLRQ DQG ZDUHKRXVLQJXVHV KLJKZD\VRUUDLOWRLPSOHPHQWDSSURSULDWHPLWLJDWLRQPHDVXUHVWRUHGXFH LQGRRUDLUSROOXWLRQVXFKDVDLUILOWUDWLRQYHQWLODWLRQV\VWHPVODQGVFDSLQJ DQGRWKHUSK\VLFDOLPSURYHPHQWVDVUHFRPPHQGHGE\WKH&DOLIRUQLD$LU 5HVRXUFHV%RDUGDQGRUWKH%D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW Action CHEJ-3.2.10DLQWDLQ7UXFNURXWHPDSWRPLQLPL]HH[SRVXUH0DLQWDLQ DQXSWRGDWHWUXFNURXWHVPDSWKDWPLQLPL]HVH[SRVXUHVWRVHQVLWLYHODQG XVHV3URKLELWWKHGHVLJQDWLRQRIQHZWUXFNURXWHVRQORFDOQHLJKERUKRRG VWUHHWVLQ6RXWK6DQ)UDQFLVFR Action CHEJ-3.2.2$GRSWDQRUGLQDQFHHVWDEOLVKLQJYHKLFOHLGOLQJUHVWULFWLRQV (VWDEOLVKDORFDORUGLQDQFHWKDWH[FHHGVWKH6WDWHYHKLFOHLGOLQJ UHVWULFWLRQVZKHUHDSSURSULDWHLQFOXGLQJUHVWULFWLRQVIRUEXVOD\RYHUV GHOLYHU\YHKLFOHVWUXFNVDWZDUHKRXVHVDQGGLVWULEXWLRQIDFLOLWLHVDQGWD[LV SDUWLFXODUO\ZKHQWKHVHDFWLYLWLHVWDNHSODFHQHDUVHQVLWLYHODQGXVHV VFKRROVKHDOWKFDUHIDFLOLWLHVDIIRUGDEOHKRXVLQJDQGHOGHUDQGFKLOGFDUH FHQWHUV0DQDJHWUXFNLGOLQJLQQHZUHVLGHQWLDOQHLJKERUKRRGVLQ /LQGHQYLOOHDQG(DVWRI Community Resilience Element CR-6.1 6XSSRUWUHVLOLHQWEXLOGLQJGHVLJQ6XSSRUWUHVLOLHQWEXLOGLQJGHVLJQE\KHOSLQJ UHVLGHQWVZHDWKHUL]HKRPHVWRNHHSWKHPFRROHUDQGPRUHHQHUJ\HIILFLHQWDQGWR LPSURYHLQGRRUDLUTXDOLW\ CP-3.1.1 ,QFHQWLYL]HHQHUJ\HIILFLHQWQHZFRQVWUXFWLRQ3URYLGHLQFHQWLYHVWRHQFRXUDJH QHZFRQVWUXFWLRQWRH[FHHG&DOLIRUQLD¶V%XLOGLQJ(QHUJ\(IILFLHQF\6WDQGDUGV RXWOLQHGLQ7LWOH3DUW City of South San Francisco Climate Action Plan BNC 1.1 ,PSURYHWKHHQHUJ\HIILFLHQF\RIQHZFRQVWUXFWLRQ3URYLGHDFRPELQDWLRQRI ILQDQFLDODQGGHYHORSPHQWSURFHVVLQFHQWLYHVHJ([SHGLWHGSHUPLWWLQJ)$5 LQFUHDVHVHWFWRHQFRXUDJHQHZGHYHORSPHQWWRH[FHHG7LWOHHQHUJ\HIILFLHQF\ VWDQGDUG TL 2.2 7'0 3URJUDP ,PSOHPHQWPRQLWRU DQG HQIRUFH FRPSOLDQFH ZLWKWKH &LW\¶V 7'02UGLQDQFH WW 2.1 ,QGRRU:DWHU(IILFLHQF\6WDQGDUGV5HTXLUHKLJKHIILFLHQF\IL[WXUHVLQDOOQHZ FRQVWUXFWLRQ DQG PDMRU UHQRYDWLRQV FRPSDUDEOH WR &$/*UHHQ 7LHURU VWDQGDUGV Goal CP-1: A Carbon Neutral Community CP-1.10DLQWDLQDQGXSGDWHWKH&OLPDWH$FWLRQ3ODQ0DLQWDLQDQGUHJXODUO\XSGDWH WKH &LW\¶V &OLPDWH $FWLRQ 3ODQ WR UHGXFH JUHHQKRXVH JDV *+* HPLVVLRQV JHQHUDWHGZLWKLQWKH&LW\(QVXUHWKH&LW\¶V*+*HPLVVLRQWDUJHWLVFRQVLVWHQWZLWK &DOLIRUQLD¶V*+*UHGXFWLRQJRDOVLQRUGHUWREHDTXDOLILHGSODQIRU&DOLIRUQLD (QYLURQPHQWDO4XDOLW\$FW&(4$ CP-1.20RQLWRUSURJUHVVWRZDUGVFDUERQQHXWUDOLW\JRDO7UDFNDQGUHSRUWSURJUHVV WRZDUGVDFKLHYLQJWKH&LW\¶VJUHHQKRXVHJDVUHGXFWLRQJRDO Goal CP-2: A resilient and fossil fuel free energy system CP-2.10DLQWDLQ3HQLQVXOD&OHDQ(QHUJ\PHPEHUVKLS0DLQWDLQ&LW\PHPEHUVKLSLQ 3HQLQVXOD&OHDQ(QHUJ\3&(DQGFRQWLQXHWRZRUNWRPDLQWDLQDKLJKOHYHORI SULYDWHSURSHUW\RZQHUSDUWLFLSDWLRQLQ3&( Goal CP-3: Green buildings are the standard in South San Francisco for new construction and major renovations CP-3.1%XLOGLQJFRGHPDLQWHQDQFHIRUQHZDQGPDMRUUHQRYDWLRQVHQHUJ\HIILFLHQF\ 5HJXODUO\XSGDWH6RXWK6DQ)UDQFLVFR¶VEXLOGLQJFRGHVWRLPSURYHWKHHQHUJ\ SHUIRUPDQFHRIQHZFRQVWUXFWLRQDQGPDMRUUHPRGHOVDQGWRSKDVHLQUHTXLUHPHQWV LQSUHGLFWDEOHZD\V CP-3.4$GRSW (OHFWULF 9HKLFOH FKDUJLQJ UHDFK FRGH$GRSW KLJKHU HOHFWULF YHKLFOH FKDUJLQJUHTXLUHPHQWVWKDQ&$/*UHHQIRUPXOWLIDPLO\DQGQRQUHVLGHQWLDOQHZ FRQVWUXFWLRQ &LW\RI6RXWK6DQ)UDQFLVFR²*HQHUDO3ODQ8SGDWH=RQLQJ&RGH$PHQGPHQWVDQG&OLPDWH $FWLRQ3ODQ3URJUDP(,5 7KH&LW\¶V(QYLURQPHQWDO,PSDFW5HSRUW(,5DGGUHVVHGDLUTXDOLW\LPSDFWVDVVRFLDWHGZLWKODQG XVHGHYHORSPHQWLQ6RXWK6DQ)UDQFLVFRWKDWLVFRQVLVWHQWZLWKWKH*HQHUDO3ODQ8SGDWH]RQLQJ FRGHDPHQGPHQWVDQG&OLPDWH$FWLRQ3ODQ$LUTXDOLW\LPSDFWVDQGPLWLJDWLRQPHDVXUHVZHUH LGHQWLILHGLQWKH(,5 6LJQLILFDQFH7KUHVKROGV ,Q-XQH%$$40'DGRSWHGWKUHVKROGVRIVLJQLILFDQFHWRDVVLVWLQWKHUHYLHZRISURMHFWV XQGHU&(4$DQGWKHVHVLJQLILFDQFHWKUHVKROGVZHUHFRQWDLQHGLQWKH'LVWULFW¶V&(4$$LU 4XDOLW\*XLGHOLQHV7KHVHWKUHVKROGVZHUHGHVLJQHGWRHVWDEOLVKWKHOHYHODWZKLFK%$$40' EHOLHYHGDLUSROOXWLRQHPLVVLRQVZRXOGFDXVHVLJQLILFDQWHQYLURQPHQWDOLPSDFWVXQGHU&(4$7KH WKUHVKROGV ZHUH FKDOOHQJHG WKURXJK D VHULHV RI FRXUW FKDOOHQJHV DQG ZHUH PRVWO\ XSKHOG %$$40'XSGDWHGLWVWKUHVKROGVLQWKH&(4$$LU4XDOLW\*XLGHOLQHVLQDQGDJDLQLQ *+*WKUHVKROGVRQO\7KHODWHVW%$$40'VLJQLILFDQFHWKUHVKROGVZKLFKZHUHXVHGLQWKLV DQDO\VLVDQGDUHVXPPDUL]HGLQ7DEOH,PSDFWVDERYHWKHWKUHVKROGDUHFRQVLGHUHGSRWHQWLDOO\ VLJQLILFDQW &LW\RI6RXWK6DQ)UDQFLVFR General Plan Update, Zoning Code Amendments, and Climate Action Plan Draft Program EIR6HHKWWSVVKDSHVVIFRPZSFRQWHQWXSORDGV66)*38)LQDO(,5B&RPELQHGSGI 7DEOH %$$40'&(4$$LU4XDOLW\6LJQLILFDQFH7KUHVKROGV &ULWHULD$LU 3ROOXWDQW &RQVWUXFWLRQ7KUHVKROGV2SHUDWLRQDO7KUHVKROGV $YHUDJH'DLO\(PLVVLRQV OEVGD\ $YHUDJH'DLO\ (PLVVLRQVOEVGD\ $QQXDO$YHUDJH (PLVVLRQVWRQV\HDU 52* 12[ 30([KDXVW 30([KDXVW &2 1RW$SSOLFDEOH SSPKRXUDYHUDJHRUSSPKRXU DYHUDJH )XJLWLYH'XVW&RQVWUXFWLRQ'XVW2UGLQDQFHRU RWKHU%HVW0DQDJHPHQW3UDFWLFHV1RW$SSOLFDEOH +HDOWK5LVNVDQG +D]DUGV 6LQJOH6RXUFHV:LWKLQ IRRW=RQHRI,QIOXHQFH &RPELQHG6RXUFHV&XPXODWLYHIURPDOO VRXUFHVZLWKLQIRRW]RQHRILQIOXHQFH ([FHVV&DQFHU5LVN SHURQHPLOOLRQ SHURQHPLOOLRQ +D]DUG,QGH[ ,QFUHPHQWDODQQXDO 30JPJP *UHHQKRXVH*DV(PLVVLRQV /DQG8VH3URMHFWV± 0XVW,QFOXGH$RU % $3URMHFWVPXVWLQFOXGHDWDPLQLPXPWKHIROORZLQJSURMHFWGHVLJQHOHPHQWV %XLOGLQJV D7KHSURMHFWZLOOQRWLQFOXGHQDWXUDOJDVDSSOLDQFHVRUQDWXUDOJDVSOXPELQJ LQERWKUHVLGHQWLDODQGQRQUHVLGHQWLDOGHYHORSPHQW E7KHSURMHFWZLOOQRWUHVXOWLQDQ\ZDVWHIXOLQHIILFLHQWRUXQQHFHVVDU\HQHUJ\ XVDJHDVGHWHUPLQHGE\WKHDQDO\VLVUHTXLUHGXQGHU&(4$6HFWLRQ EDQG6HFWLRQERIWKH6WDWH&(4$*XLGHOLQHV 7UDQVSRUWDWLRQ D$FKLHYHDUHGXFWLRQLQSURMHFWJHQHUDWHGYHKLFOHPLOHVWUDYHOHG907 EHORZWKHUHJLRQDODYHUDJHFRQVLVWHQWZLWKWKHFXUUHQWYHUVLRQRIWKH &DOLIRUQLD&OLPDWH&KDQJH6FRSLQJ3ODQFXUUHQWO\SHUFHQWRUPHHWD ORFDOO\DGRSWHG6HQDWH%LOO907WDUJHWUHIOHFWLQJWKHUHFRPPHQGDWLRQV SURYLGHGLQWKH*RYHUQRU¶V2IILFHRI3ODQQLQJDQG5HVHDUFK¶V7HFKQLFDO $GYLVRU\RQ(YDOXDWLQJ7UDQVSRUWDWLRQ,PSDFWVLQ&(4$ L5HVLGHQWLDOSURMHFWVSHUFHQWEHORZWKHH[LVWLQJ907SHUFDSLWD LL2IILFHSURMHFWVSHUFHQWEHORZWKHH[LVWLQJ907SHUHPSOR\HH LLL5HWDLOSURMHFWVQRQHWLQFUHDVHLQH[LVWLQJ907 E$FKLHYHFRPSOLDQFHZLWKRIIVWUHHWHOHFWULFYHKLFOHUHTXLUHPHQWVLQWKHPRVW UHFHQWO\DGRSWHGYHUVLRQRI&$/*UHHQ7LHU %%HFRQVLVWHQWZLWKDORFDO*+*UHGXFWLRQVWUDWHJ\WKDWPHHWVWKHFULWHULDXQGHU6WDWH &(4$*XLGHOLQHV6HFWLRQE 1RWH52* UHDFWLYHRUJDQLFJDVHV12[ QLWURJHQR[LGHV30 FRXUVHSDUWLFXODWHPDWWHURUSDUWLFXODWHVZLWK DQDHURG\QDPLFGLDPHWHURIPLFURPHWHUVPRUOHVV30 ILQHSDUWLFXODWHPDWWHURUSDUWLFXODWHVZLWKDQ DHURG\QDPLFGLDPHWHURIPRUOHVV*+* JUHHQKRXVHJDVHV $,548$/,7<,03$&76$1'0,7,*$7,210($685(6 ,PSDFW$,5 &RQIOLFWZLWKRUREVWUXFWLPSOHPHQWDWLRQRIWKHDSSOLFDEOHDLUTXDOLW\ SODQ" %$$40'LVWKHUHJLRQDODJHQF\UHVSRQVLEOHIRURYHUVHHLQJFRPSOLDQFHZLWK6WDWHDQG)HGHUDO ODZV UHJXODWLRQV DQG SURJUDPV ZLWKLQ WKH 6DQ )UDQFLVFR %D\ $UHD $LU %DVLQ 6)%$$% %$$40' ZLWK DVVLVWDQFH IURP WKH $VVRFLDWLRQ RI %D\ $UHD *RYHUQPHQWV $%$* DQG 0HWURSROLWDQ7UDQVSRUWDWLRQ&RPPLVVLRQ07&SUHSDUHVDQGLPSOHPHQWVVSHFLILFSODQVWRPHHW WKHDSSOLFDEOHODZVUHJXODWLRQVDQGSURJUDPV7KHPRVWUHFHQWDQGFRPSUHKHQVLYHRIZKLFKLV WKHBay Area 2017 Clean Air Plan7KHSULPDU\JRDOVRIWKH&OHDQ$LU3ODQDUHWRDWWDLQDLU TXDOLW\ VWDQGDUGV UHGXFH SRSXODWLRQ H[SRVXUH DQG SURWHFW SXEOLF KHDOWK DQG UHGXFH *+* HPLVVLRQVDQGSURWHFWWKHFOLPDWH7KH%$$40'KDVDOVRGHYHORSHG&(4$JXLGHOLQHVWRDVVLVW OHDGDJHQFLHVLQHYDOXDWLQJWKHVLJQLILFDQFHRIDLUTXDOLW\DQG*+* LPSDFWV,QIRUPXODWLQJ FRPSOLDQFHVWUDWHJLHV%$$40'UHOLHVRQSODQQHGODQGXVHVHVWDEOLVKHGE\ORFDOJHQHUDOSODQV /DQGXVHSODQQLQJDIIHFWVYHKLFOHWUDYHOZKLFKLQWXUQDIIHFWVUHJLRQZLGHHPLVVLRQVRIDLU SROOXWDQWVDQG*+*V 7KH&OHDQ$LU3ODQDGRSWHGE\%$$40'LQ$SULOLQFOXGHVFRQWUROPHDVXUHVWKDWDUH LQWHQGHGWRUHGXFHDLUSROOXWDQWHPLVVLRQVLQWKH%D\$UHDHLWKHUGLUHFWO\RULQGLUHFWO\3ODQVPXVW VKRZ FRQVLVWHQF\ ZLWK WKH FRQWURO PHDVXUHV OLVWHG ZLWKLQ WKH &OHDQ $LU 3ODQ *HQHUDO 3ODQ FRQVLVWHQF\ZDVHYDOXDWHGLQWKH(,5IRUWKHGeneral Plan Update, Zoning Code Amendments, and Climate Action Plan$VLJQLILFDQWDQGXQDYRLGDEOHLPSDFWZDVLGHQWLILHGEHFDXVH907 ZRXOGLQFUHDVHDWDJUHDWHUUDWHWKDQSRSXODWLRQ0LWLJDWLRQPHDVXUHVZRXOGHQVXUHWKDWFHUWDLQ &OHDQ$LU3ODQPHDVXUHVDUHSURSHUO\LPSOHPHQWHGVRWKDWVRPHSURMHFWVGHYHORSHGXQGHUWKH *HQHUDO3ODQZRXOGQRWKDYHVLJQLILFDQWDLUTXDOLW\LPSDFWV 0LWLJDWLRQPHDVXUH00$,5DZRXOGUHGXFHFRQVWUXFWLRQSHULRGE\UHTXLULQJLQGLYLGXDOSURMHFWV IDFLOLWDWHG E\ WKH *HQHUDO 3ODQ WR LQFRUSRUDWH %DVLF &RQVWUXFWLRQ 0LWLJDWLRQ 0HDVXUHV UHFRPPHQGHGE\%$$40' %HFDXVHWKH*HQHUDO3ODQGRHVQRWFRQWDLQDODQGXVHGLDJUDPWKDWLGHQWLILHVVSHFLDORYHUOD\]RQHV DURXQGH[LVWLQJDQGSODQQHGVRXUFHVRI7$&V00$,5EZRXOGEHUHTXLUHGWRHQVXUHWKDWIXWXUH GHYHORSPHQWZRXOGUHVXOWLQOHVVWKDQVLJQLILFDQWLPSDFWVUHODWHGWRH[SRVLQJVHQVLWLYHUHFHSWRUV WRVXEVWDQWLDOSROOXWDQWFRQFHQWUDWLRQV 7RUHGXFH9HKLFOH0LOHV7UDYHOHG9070075$16IURPWKH*HQHUDO3ODQ(,5UHTXLUHVWKH &LW\WRLPSOHPHQWLWV7UDQVSRUWDWLRQ'HPDQG0DQDJHPHQW7'02UGLQDQFHDVSDUWRIWKH =RQLQJ &RGH $PHQGPHQWV DQG SDUNLQJ UHTXLUHPHQWV 7KH &LW\ VKDOO DOVR XSGDWH LWV 7'0 2UGLQDQFHDQGSDUNLQJUHTXLUHPHQWVHYHU\ILYHWRWHQ\HDUVDQGHVWDEOLVKDQ(DVWRI$UHD7ULS &DSWRDFKLHYHWKHPD[LPXPIHDVLEOHUHGXFWLRQVLQYHKLFOHWUDYHO7KH&LW\VKDOODFKLHYHWKH SHUIRUPDQFHVWDQGDUGVRXWOLQHGLQWKH7'02UGLQDQFH %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW%$$40', Final 2017 Clean Air Plan. &RQFOXVLRQ$,5 7KH3URMHFWLVFRQVLVWHQWZLWKWKH*HQHUDO3ODQEHFDXVHRILWVFRPSOLDQFHZLWK00$,5D00 $,5EDQG0075$167KHUHIRUHWKHSURMHFWZRXOGQRWFRQIOLFWZLWKWKHODWHVW&OHDQ$LU SODQQLQJHIIRUWV$GGLWLRQDOO\WKH3URMHFWZRXOGKDYHFRQVWUXFWLRQDQGRSHUDWLRQDOHPLVVLRQV EHORZWKH%$$40'WKUHVKROGVVHH,PSDFWEHORZWKHSURMHFWZRXOGEHFRQVLGHUHGXUEDQ LQILOODQGWKHSURMHFWZRXOGEHORFDWHGQHDUWUDQVLWZLWKUHJLRQDOFRQQHFWLRQV ,PSDFW$,5 5HVXOW LQ D FXPXODWLYHO\ FRQVLGHUDEOH QHW LQFUHDVH RI DQ\ FULWHULD SROOXWDQW IRU ZKLFK WKH SURMHFW UHJLRQ LV QRQDWWDLQPHQW XQGHUDQ DSSOLFDEOHIHGHUDORUVWDWHDPELHQWDLUTXDOLW\VWDQGDUG" 7KH%D\$UHDLVFRQVLGHUHGDQRQDWWDLQPHQWDUHDIRUJURXQGOHYHO2DQG30XQGHUERWKWKH )HGHUDO&OHDQ$LU$FWDQGWKH&DOLIRUQLD&OHDQ$LU$FW7KHDUHDLVDOVRFRQVLGHUHGQRQDWWDLQPHQW IRU30XQGHUWKH&DOLIRUQLD&OHDQ$LU$FWEXWQRWWKHIHGHUDODFW7KHDUHDKDVDWWDLQHGERWK 6WDWHDQG)HGHUDODPELHQWDLUTXDOLW\VWDQGDUGVIRUFDUERQPRQR[LGH$VSDUWRIDQHIIRUWWRDWWDLQ DQGPDLQWDLQDPELHQWDLUTXDOLW\VWDQGDUGVIRU230DQG30WKH%$$40'KDVHVWDEOLVKHG WKUHVKROGVRIVLJQLILFDQFHIRUWKHVHDLUSROOXWDQWVDQGWKHLUSUHFXUVRUV7KHVHWKUHVKROGVDUHIRU2 SUHFXUVRUSROOXWDQWV52*DQG12[30DQG30DQGDSSO\WRERWKFRQVWUXFWLRQSHULRGDQG RSHUDWLRQDOSHULRGLPSDFWV &RQVWUXFWLRQ3HULRG(PLVVLRQV 7KH&DOLIRUQLD(PLVVLRQV(VWLPDWRU0RGHO&DO((0RG9HUVLRQZDVXVHGWRHVWLPDWH HPLVVLRQVIURPRQVLWHFRQVWUXFWLRQDFWLYLW\FRQVWUXFWLRQYHKLFOHWULSVDQGHYDSRUDWLYHHPLVVLRQV 7KH SURMHFW ODQG XVH W\SHV DQG VL]H DQG DQWLFLSDWHG FRQVWUXFWLRQ VFKHGXOH ZHUH LQSXW WR &DO((0RG 7KH &$5% (0LVVLRQ )$&WRUV (0)$& PRGHO ZDVXVHG WR SUHGLFW HPLVVLRQVIURPFRQVWUXFWLRQWUDIILFZKLFKLQFOXGHVZRUNHUWUDYHOYHQGRUWUXFNVDQGKDXOWUXFNV 7KH&DO((0RGPRGHORXWSXWDORQJZLWKFRQVWUXFWLRQLQSXWVDUHLQFOXGHGLQAttachment 2 DQG (0)$& YHKLFOH HPLVVLRQVPRGHOLQJRXWSXWVDUH LQFOXGHGLQAttachment 3 &DO((0RG,QSXWV Land Uses 7KHSURSRVHGSURMHFWODQGXVHVZHUHHQWHUHGLQWR&DO((0RGDVGHVFULEHGLQ7DEOH 7DEOH 6XPPDU\RI3URMHFW/DQG8VH,QSXWV 3URMHFW/DQG8VHV6L]H8QLWV6TXDUH)HHWVI$FUHDJH 5HVHDUFK 'HYHORSPHQW VI (QFORVHG3DUNLQJZLWK(OHYDWRU 3DUNLQJ6SDFHV 6HH&$5%¶V(0)$&(PLVVLRQV,QYHQWRU\DWKWWSVDUEFDJRYHPIDFHPLVVLRQVLQYHQWRU\ Construction Inputs &DO((0RGFRPSXWHVDQQXDOHPLVVLRQVIRUFRQVWUXFWLRQWKDWDUHEDVHGRQWKHSURMHFWW\SHVL]H DQGDFUHDJH7KHPRGHOSURYLGHVHPLVVLRQHVWLPDWHVIRUERWKRQVLWHDQGRIIVLWHFRQVWUXFWLRQ DFWLYLWLHV2QVLWHDFWLYLWLHVDUHSULPDULO\PDGHXSRIFRQVWUXFWLRQHTXLSPHQWHPLVVLRQVZKLOHRII VLWHDFWLYLW\LQFOXGHVZRUNHUKDXOLQJDQGYHQGRUWUDIILF7KHFRQVWUXFWLRQEXLOGRXWVFHQDULR LQFOXGLQJHTXLSPHQWOLVWDQGVFKHGXOHZHUHEDVHGRQ&DO((0RGGHIDXOWVWKDWZHUHUHYLHZHGDQG VOLJKWO\PRGLILHGE\WKHDSSOLFDQW 7KHFRQVWUXFWLRQHTXLSPHQWZRUNVKHHWVSURYLGHGE\WKHDSSOLFDQWLQFOXGHGWKHVFKHGXOHIRUHDFK SKDVH:LWKLQHDFKSKDVHWKHTXDQWLW\RIHTXLSPHQWWREHXVHGDYHUDJHKRXUVSHUGD\DQGWRWDO QXPEHURIZRUNGD\VZDVSURYLGHGE\WKHDSSOLFDQW0XFKRIWKHVWDWLRQDU\HTXLSPHQWXVHGGXULQJ WKHEXLOGLQJSKDVHZRXOGEHHOHFWULFSRZHUHG6LQFHGLIIHUHQWHTXLSPHQWZRXOGKDYHGLIIHUHQW HVWLPDWHVRIWKHZRUNLQJGD\VSHUSKDVHWKHKRXUVSHUGD\IRUHDFKSKDVHZDVFRPSXWHGE\ GLYLGLQJWKHWRWDOQXPEHURIKRXUVWKDWWKHHTXLSPHQWZRXOGEHXVHGE\WKHWRWDOQXPEHURIGD\V LQWKDWSKDVH $SKDVHIRULQWHULRUZRUNZDVQRWSURYLGHG7KHUHIRUHLWZDVDVVXPHGWKDWLQWHULRUZRUNZRXOG EHFRQGXFWHGGXULQJWKHODVWPRQWKVRIWKHFRQVWUXFWLRQSHULRGWKDWLQYROYHVILQLVKLQJODQGVFDSH DQGSDYLQJZRUN7KLVSKDVHZRXOGRFFXULQDQG 7KHFRQVWUXFWLRQVFKHGXOHDVVXPHGWKDWWKHHDUOLHVWSRVVLEOHVWDUWGDWHZRXOGEH$XJXVWDQG ZRXOGEHEXLOWRXWRYHUDSHULRGRIDSSUR[LPDWHO\PRQWKVRUFRQVWUXFWLRQZRUNGD\V7KH HDUOLHVW\HDURIIXOORSHUDWLRQZDVDVVXPHGWREH Construction Truck Traffic Emissions &RQVWUXFWLRQZRXOGSURGXFHWUDIILFLQWKHIRUPRIZRUNHUWULSVDQGWUXFNWUDIILF7KHWUDIILFUHODWHG HPLVVLRQVDUHEDVHGRQZRUNHUDQGYHQGRUWULSHVWLPDWHVSURGXFHGE\&DO((0RGDQGKDXOWULSV WKDWZHUHFRPSXWHGEDVHGRQWKHHVWLPDWHRIGHPROLWLRQPDWHULDOWREHH[SRUWHGVRLOPDWHULDO LPSRUWHG DQGRU H[SRUWHG WR WKH VLWH DQG WKH HVWLPDWH RI FRQFUHWH DQG DVSKDOW WUXFN WULSV &DO((0RGSURYLGHVGDLO\HVWLPDWHVRIZRUNHUDQGYHQGRUWULSVIRUHDFKDSSOLFDEOHSKDVH7KH WRWDOWULSVIRUWKRVHZHUHFRPSXWHGE\PXOWLSO\LQJWKHGDLO\WULSUDWHE\WKHQXPEHURIGD\VLQWKDW SKDVH+DXOWULSVIRUGHPROLWLRQDQGJUDGLQJZHUHHVWLPDWHGIURPWKHSURYLGHGGHPROLWLRQDQG JUDGLQJYROXPHVXVLQJ&DO((0RGGHIDXOWKDXOLQJWUXFNWULSUDWHV7KHQXPEHURIFRQFUHWHDQG DVSKDOWWRWDOURXQGKDXOWULSVZHUHSURYLGHGIRUWKHSURMHFWDQGFRQYHUWHGWRWRWDORQHZD\WULSV DVVXPLQJWZRWULSVSHUGHOLYHU\ 7KH ODWHVW YHUVLRQ RI WKH &DO((0RG PRGHO LV EDVHG RQ WKH ROGHUYHUVLRQ RI WKH &$5% (0)$& PRWRU YHKLFOH HPLVVLRQ IDFWRUPRGHO 7KLV PRGHO KDVEHHQ VXSHUVHGHG E\ WKH (0)$& PRGHO KRZHYHU &DO((0RG KDV QRW EHHQ XSGDWHG WR LQFOXGH (0)$& 7KHUHIRUHWKHFRQVWUXFWLRQWUDIILFLQIRUPDWLRQZDVFRPELQHGZLWK(0)$&PRWRUYHKLFOH HPLVVLRQVIDFWRUV(0)$&SURYLGHVDJJUHJDWHHPLVVLRQUDWHVLQJUDPVSHUPLOHIRUHDFK YHKLFOHW\SH7KHYHKLFOHPL[IRUWKLVVWXG\ZDVEDVHGRQ&DO((0RGGHIDXOWDVVXPSWLRQVZKHUH ZRUNHUWULSVDUHDVVXPHGWREHFRPSULVHGRIOLJKWGXW\DXWRV(0)$&FDWHJRU\/'$DQGOLJKW GXW\WUXFNV(0)$&FDWHJRU\/'7DQG/'79HQGRUWULSVDUHFRPSULVHGRIGHOLYHU\DQGODUJH WUXFNV (0)$& FDWHJRU\ 0+'7 DQG ++'7 DQG KDXO WULSV LQFOXGLQJ FHPHQW WUXFNV DUH FRPSULVHGRIODUJHWUXFNV(0)$&FDWHJRU\++'77UDYHOGLVWDQFHVDUHEDVHGRQ&DO((0RG GHIDXOWOHQJWKVZKLFKDUHPLOHVIRUZRUNHUWUDYHOPLOHVIRUYHQGRUWULSVDQGPLOHVIRU KDXOLQJVRLOLPSRUWH[SRUW6LQFH&DO((0RGGRHVQRWDGGUHVVFHPHQWWUXFNVWKHVHZHUHWUHDWHG DVYHQGRUWUDYHOGLVWDQFHV(DFKWULSZDVDVVXPHGWRLQFOXGHDQLGOHWLPHRIPLQXWHV(PLVVLRQV DVVRFLDWHGZLWKYHKLFOHVWDUWVZHUHDOVRLQFOXGHG2QURDGHPLVVLRQVLQ6DQ0DWHR&RXQW\IRU ZDVXVHGLQWKHVHFDOFXODWLRQV7DEOHSURYLGHVWKHWUDIILFLQSXWVWKDWZHUHFRPELQHG ZLWKWKH(0)$&HPLVVLRQGDWDEDVHWRFRPSXWHYHKLFOHHPLVVLRQV 7DEOH &RQVWUXFWLRQ7UDIILF'DWD8VHGIRU(0)$&0RGHO5XQV &DO((0RG5XQ/DQG 8VHVDQG&RQVWUXFWLRQ 3KDVH 7ULSVE\7ULS7\SH 1RWHV 7RWDO :RUNHU 7RWDO 9HQGRU 7RWDO +DXO 9HKLFOHPL[ /'$ /'7 /'7 0+'7 ++'7++'7 7ULS/HQJWKPLOHV &DO((0RGGHIDXOWGLVWDQFHZLWK PLQWUXFNLGOHWLPH 'HPROLWLRQ VIEXLOGLQJDQGWRQV SDYHPHQWGHPROLWLRQ&DO((0RG GHIDXOWZRUNHUWULSV *UDGLQJ F\VRLOH[SRUW &DO((0RGGHIDXOWZRUNHUWULSV %XLOGLQJ&RQVWUXFWLRQ FRQFUHWHURXQGWULSV &DO((0RGGHIDXOWZRUNHUDQG YHQGRUWULSV 3DYLQJ F\DVSKDOWSDYLQJ &DO((0RGGHIDXOWZRUNHUWULSV %XLOGLQJ,QWHULRU &DO((0RGGHIDXOWZRUNHUWULSV %DVHGRQ(0)$&OLJKWGXW\YHKLFOHIOHHWPL[IRU6DQ0DWHR&RXQW\ ,QFOXGHVGHPROLWLRQWULSVHVWLPDWHGE\&DO((0RGEDVHGRQDPRXQWRIPDWHULDOWREHUHPRYHG$VSKDOWWULSV HVWLPDWHGEDVHGRQGDWDSURYLGHGE\WKHDSSOLFDQW &RQFOXVLRQ$,5 $YHUDJHGDLO\HPLVVLRQVZHUHDQQXDOL]HGIRUHDFK\HDURIFRQVWUXFWLRQE\GLYLGLQJWKHDQQXDO FRQVWUXFWLRQHPLVVLRQVDQGGLYLGLQJWKRVHHPLVVLRQVE\WKHQXPEHURIDFWLYHZRUNGD\VGXULQJWKDW \HDU7DEOHVKRZVWKHDQQXDOL]HGDYHUDJHGDLO\FRQVWUXFWLRQHPLVVLRQVRI52*12;30 H[KDXVWDQG30H[KDXVWGXULQJFRQVWUXFWLRQRIWKHSURMHFW$VLQGLFDWHGLQ7DEOHSUHGLFWHG DQQXDOL]HG SURMHFW FRQVWUXFWLRQ HPLVVLRQV ZRXOG QRW H[FHHG WKH%$$40' VLJQLILFDQFH WKUHVKROGVGXULQJDQ\\HDURIFRQVWUXFWLRQ 7DEOH &RQVWUXFWLRQ3HULRG(PLVVLRQVȱ <HDU52*12[30 ([KDXVW 30 ([KDXVW Construction Emissions Total (Tons) Average Daily Construction Emissions (pounds/day) FRQVWUXFWLRQZRUNGD\V BAAQMD Thresholds (pounds per day)54OEVGD\ 54OEVGD\ 82OEVGD\ 54OEVGD\ ([FHHG7KUHVKROG"1R1R1R1R &RQVWUXFWLRQDFWLYLWLHVSDUWLFXODUO\GXULQJVLWHSUHSDUDWLRQDQGJUDGLQJZRXOGWHPSRUDULO\ JHQHUDWHIXJLWLYHGXVWLQWKHIRUPRI30DQG306RXUFHVRIIXJLWLYHGXVWZRXOGLQFOXGH GLVWXUEHGVRLOVDWWKHFRQVWUXFWLRQVLWHDQGWUXFNVFDUU\LQJXQFRYHUHGORDGVRIVRLOV8QOHVV SURSHUO\FRQWUROOHGYHKLFOHVOHDYLQJWKHVLWHZRXOGGHSRVLWPXGRQORFDOVWUHHWVZKLFKFRXOGEH DQDGGLWLRQDOVRXUFHRIDLUERUQHGXVWDIWHULWGULHV7KH%$$40'&(4$$LU4XDOLW\*XLGHOLQHV FRQVLGHUWKHVHLPSDFWVWREHOHVVWKDQVLJQLILFDQWLIEHVWPDQDJHPHQWSUDFWLFHVDUHLPSOHPHQWHG WRUHGXFHWKHVHHPLVVLRQVMitigation Measure AQ-1 would implement BAAQMD-recommended best management practices Mitigation Measure AQ-1 - ,PSOHPHQW*HQHUDO3ODQ00$,5D 00$,5D 7KLVPLWLJDWLRQUHTXLUHVWKDWLQGLYLGXDOGHYHORSPHQWVIDFLOLWDWHGE\WKH&LW\¶V*HQHUDO3ODQVKDOO LQFRUSRUDWHWKHIROORZLQJ%DVLF&RQVWUXFWLRQ0LWLJDWLRQ0HDVXUHVUHFRPPHQGHGE\%$$40' x$OO H[SRVHG VXUIDFHV HJ SDUNLQJ DUHDV VWDJLQJ DUHDV VRLOSLOHV JUDGHG DUHDV DQG XQSDYHGDFFHVVURDGVVKDOOEHZDWHUHGWZRWLPHVSHUGD\ x$OOKDXOWUXFNVWUDQVSRUWLQJVRLOVDQGRURWKHUORRVHPDWHULDORIIVLWHVKDOOEHFRYHUHG x$OOYLVLEOHPXGRUGLUWWUDFNRXWRQWRDGMDFHQWSXEOLFURDGVVKDOOEHUHPRYHGXVLQJZHW SRZHUYDFXXPVWUHHWVZHHSHUVDWOHDVWRQFHSHUGD\7KHXVHRIGU\SRZHUVZHHSLQJLV SURKLELWHG x$OOYHKLFOHVSHHGVRQXQSDYHGURDGVVKDOOEHOLPLWHGWRPSK x$OOURDGZD\VGULYHZD\VDQGVLGHZDONVWREHSDYHGVKDOOEHFRPSOHWHGDVVRRQDVSRVVLEOH %XLOGLQJSDGVVKDOOEHODLGDVVRRQDVSRVVLEOHDIWHUJUDGLQJXQOHVVVHHGLQJRUVRLOELQGHUV DUHXVHG x,GOLQJWLPHVVKDOOEHPLQLPL]HGHLWKHUE\VKXWWLQJHTXLSPHQWRIIZKHQQRWLQXVHRU UHGXFLQJWKHPD[LPXPLGOLQJWLPHWRPLQXWHVDVUHTXLUHGE\WKH&DOLIRUQLD$LUERUQH 7R[LFV &RQWURO 0HDVXUH >$7&0@ 7LWOH 6HFWLRQ RI WKH &DOLIRUQLD &RGH RI 5HJXODWLRQV&OHDUVLJQDJHVKDOOEHSURYLGHGIRUFRQVWUXFWLRQZRUNHUVDWDOODFFHVVSRLQWV x$OOFRQVWUXFWLRQHTXLSPHQWVKDOOEHPDLQWDLQHGDQGSURSHUO\WXQHGLQDFFRUGDQFHZLWK PDQXIDFWXUHU¶VVSHFLILFDWLRQV$OOHTXLSPHQWVKDOOEHFKHFNHGE\DFHUWLILHGPHFKDQLFDQG GHWHUPLQHGWREHUXQQLQJLQSURSHUFRQGLWLRQSULRUWRRSHUDWLRQ x3ULRUWRWKHFRPPHQFHPHQWRIFRQVWUXFWLRQDFWLYLWLHVLQGLYLGXDOSURMHFWSURSRQHQWVVKDOO SRVWDSXEOLFO\YLVLEOHVLJQZLWKWKHWHOHSKRQHQXPEHUDQGSHUVRQWRFRQWDFWDWWKH/HDG $JHQF\UHJDUGLQJGXVWFRPSODLQWV7KLVSHUVRQVKDOOUHVSRQGDQGWDNHFRUUHFWLYHDFWLRQ ZLWKLQKRXUV7KH%$$40'SKRQHQXPEHUVKDOODOVREHYLVLEOHWRHQVXUHFRPSOLDQFH ZLWKDSSOLFDEOHUHJXODWLRQV Effectiveness of Mitigation Measure AQ-1 7KHPHDVXUHVDERYHDUHFRQVLVWHQWZLWK%$$40'UHFRPPHQGHGEDVLFFRQWUROPHDVXUHVIRU UHGXFLQJIXJLWLYHSDUWLFXODWHPDWWHUWKDWDUHFRQWDLQHGLQWKH%$$40'&(4$$LU4XDOLW\ *XLGHOLQHV7KHPHDVXUHVDUHDOVRFRQVLVWHQWZLWKPLWLJDWLRQPHDVXUH00$,5DIRXQGLQWKH 6RXWK6DQ)UDQFLVFR*HQHUDO3ODQ(,5 2SHUDWLRQDO3HULRG(PLVVLRQV 2SHUDWLRQDODLUHPLVVLRQVIURPWKHSURMHFWZRXOGEHJHQHUDWHGSULPDULO\IURPDXWRVGULYHQE\ IXWXUHHPSOR\HHVVL[GLHVHOILUHGHPHUJHQF\JHQHUDWRUVDQGVL[FRROLQJWRZHUV(YDSRUDWLYH HPLVVLRQVIURPDUFKLWHFWXUDOFRDWLQJVDQGPDLQWHQDQFHSURGXFWVFODVVLILHGDVFRQVXPHUSURGXFWV DUHW\SLFDOHPLVVLRQVIURPWKHVHW\SHVRIXVHV&DO((0RGZDVXVHGWRHVWLPDWHHPLVVLRQVIURP RSHUDWLRQRIWKHSURSRVHGSURMHFWDVVXPLQJIXOOEXLOGRXW &DO((0RG,QSXWV Land Uses 7KHSURMHFWODQGXVHVZHUHLQSXWWR&DO((0RGDVGHVFULEHGDERYHIRUWKHFRQVWUXFWLRQSHULRG PRGHOLQJ Model Year (PLVVLRQVDVVRFLDWHGZLWKYHKLFOHWUDYHOGHSHQGRQWKH\HDURIDQDO\VLVEHFDXVHHPLVVLRQFRQWURO WHFKQRORJ\UHTXLUHPHQWVDUHSKDVHGLQRYHUWLPH7KHUHIRUHWKHHDUOLHUWKH\HDUDQDO\]HGLQWKH PRGHOWKHKLJKHUWKHHPLVVLRQUDWHVXWLOL]HGE\&DO((0RG7KHHDUOLHVW\HDURIIXOORSHUDWLRQ ZRXOGEHLIFRQVWUXFWLRQEHJLQVLQ(PLVVLRQVDVVRFLDWHGZLWKEXLOGRXWODWHUWKDQ ZRXOGEHORZHU Traffic Information &DO((0RGDOORZVWKHXVHUWRHQWHUVSHFLILFYHKLFOHWULSJHQHUDWLRQUDWHV3URMHFWVSHFLILFWUDIILF WULS JHQHUDWLRQ HVWLPDWHV ZHUH SURYLGHG IRU WKLV DVVHVVPHQW 7KH SURMHFW ZRXOG SURGXFH DSSUR[LPDWHO\GDLO\WULSV0075$16RIWKH*HQHUDO3ODQ(,5UHTXLUHVWKHSURMHFW (PDLOIURP5HEHFFD$XOG6HSWHPEHU VSRQVRUWRLPSOHPHQWWKH&LW\¶V7'02UGLQDQFHDVSDUWRIWKH=RQLQJ&RGH$PHQGPHQWVDQG SDUNLQJUHTXLUHPHQWV7KH7'02UGLQDQFHUHTXLUHVWKDWDPD[LPXPRISHUFHQWRIWKHSURMHFW¶V WRWDO HPSOR\HHV FRPPXWH DORQH YLD FDU GXULQJ SHDN WUDIILF SHULRGV 6RPH RI WKH ZD\V WKDW FRPSOLDQFHZLWKWKLVFRGHFDQEHDFKLHYHGDUHWRDOORZHPSOR\HHVIOH[LEOHZRUNKRXUVVRWKDWWKHLU FRPPXWHLVGXULQJRIISHDNKRXUVKDYLQJHPSOR\HHVXWLOL]HRWKHUPHWKRGVRIWUDYHOVXFKDVSXEOLF WUDQVLWRUHQFRXUDJLQJFDUSRROLQJE\UHVHUYLQJSDUNLQJVSDFHVIRUFDUSRROLQJYHKLFOHV7KLVLV SUHGLFWHGWRUHVXOWLQDSHUFHQWUHGXFWLRQLQWULSV7KHGDLO\WULSJHQHUDWLRQZDVFDOFXODWHG XVLQJWKHVL]HRIWKHSURMHFWDQGWKHWRWDODXWRPRELOHWULSV7KH6DWXUGD\DQG6XQGD\WULSUDWHV ZHUHDGMXVWHGE\PXOWLSO\LQJWKHUDWLRRIWKH&DO((0RGGHIDXOWUDWHVIRU6DWXUGD\DQG6XQGD\ WULSVWRWKHGHIDXOWZHHNGD\UDWHZLWKWKHSURMHFWVSHFLILFGDLO\ZHHNGD\WULSUDWH7KHGHIDXOWWULS OHQJWKVDQGWULSW\SHVVSHFLILHGE\&DO((0RGZHUHXVHG EMFAC2021 Adjustment 7KHYHKLFOHHPLVVLRQIDFWRUVDQGIOHHWPL[XVHGLQ&DO((0RGDUHEDVHGRQ(0)$&ZKLFK LVDQROGHU&$5%HPLVVLRQLQYHQWRU\IRURQURDGDQGRIIURDGPRELOHVRXUFHV6LQFHWKHUHOHDVH RI &DO((0RG 9HUVLRQ QHZ HPLVVLRQ IDFWRUV KDYH EHHQ SURGXFHG E\ &$5% (0)$&EHFDPHDYDLODEOHIRUXVHLQ-DQXDU\,WLQFOXGHVWKHODWHVWGDWDRQ&DOLIRUQLD¶V FDUDQGWUXFNIOHHWVDQGWUDYHODFWLYLW\7KH&DO((0RGYHKLFOHHPLVVLRQIDFWRUVDQGIOHHWPL[ZHUH XSGDWHGZLWKWKHHPLVVLRQUDWHVDQGIOHHWPL[IURP(0)$&ZKLFKZHUHDGMXVWHGZLWKWKH &$5%(0)$&RIIPRGHODGMXVWPHQWIDFWRUV2QURDGHPLVVLRQUDWHVIURP6DQ0DWHR &RXQW\ZHUHXVHG6HHAttachment 30RUHGHWDLOVDERXWWKHXSGDWHVLQHPLVVLRQVFDOFXODWLRQ PHWKRGRORJLHVDQGGDWDDUHDYDLODEOHLQWKH(0)$&7HFKQLFDO6XSSRUW'RFXPHQW Energy *+*HPLVVLRQVPRGHOLQJLQFOXGHVWKRVHLQGLUHFWHPLVVLRQVIURPHOHFWULFLW\FRQVXPSWLRQ7KH PRGHOKDVDGHIDXOWUDWHRISRXQGVRI&2SHUPHJDZDWWRIHOHFWULFLW\SURGXFHGZKLFKLVEDVHG RQ3HQLQVXOD&OHDQ(QHUJ\¶VHPLVVLRQVUDWH Project Generators 7KHSURMHFWZRXOGLQFOXGHWZRHPHUJHQF\JHQHUDWRUVIRUHDFKEXLOGLQJDEDVHJHQHUDWRUDQGD WHQDQW JHQHUDWRUIRU DWRWDO RI VL[ JHQHUDWRUV $OO WKUHHEDVH JHQHUDWRUV ZRXOGEH N: JHQHUDWRUVSRZHUHGE\DKRUVHSRZHUKSGLHVHOILUHGHQJLQH7KHWHQDQWJHQHUDWRUVZLOOEH WZRN:JHQHUDWRUVSRZHUHGE\DKSGLHVHOILUHGHQJLQHDQGRQHN:JHQHUDWRU SRZHUHGE\DKSGLHVHOILUHGHQJLQH7KHVHJHQHUDWRUVZRXOGEHWHVWHGSHULRGLFDOO\DQGSRZHU WKHEXLOGLQJVLQWKHHYHQWRIDSRZHUIDLOXUH)RUPRGHOLQJSXUSRVHVLWZDVDVVXPHGWKDWWKH JHQHUDWRUV ZRXOG EH RSHUDWHG SULPDULO\ IRU WHVWLQJ DQG PDLQWHQDQFH SXUSRVHV &$5% DQG %$$40'UHTXLUHPHQWVOLPLWWKHVHHQJLQHRSHUDWLRQVWRKRXUVHDFKSHU\HDURIQRQHPHUJHQF\ 7KHSURMHFWZLOOEHUHTXLUHGWRLPSOHPHQWD7'0SURJUDPFRQVLVWHQWZLWKWKHUHYLVHG&KDSWHURIWKH 0XQLFLSDO&RGHDQGZRXOGEHUHTXLUHGWRDFKLHYHDPD[LPXPRISHUFHQWRIHPSOR\HHVFRPPXWLQJYLDGULYLQJ DORQH7KH7'0UHGXFWLRQDVVXPHVWKDWRIWKHHPSOR\HHVZLOOGULYHDORQHDQGWKHUHVWRIWKHHPSOR\HHVZLOO FRPPXWHYLDWUDQVLWFDUSRROELNHRUZDON 6HH&$5%KWWSVZZDUEFDJRYRXUZRUNSURJUDPVPRELOHVRXUFHHPLVVLRQVLQYHQWRU\URDG GRFXPHQWDWLRQPVHLPRGHOLQJWRROVHPIDF RSHUDWLRQ'XULQJWHVWLQJSHULRGVWKHHQJLQHZRXOGW\SLFDOO\EHUXQIRUOHVVWKDQRQHKRXU7KH HQJLQHVZRXOGEHUHTXLUHGWRPHHW&$5%DQG(3$HPLVVLRQVWDQGDUGVDQGFRQVXPHFRPPHUFLDOO\ DYDLODEOH &DOLIRUQLD ORZVXOIXU GLHVHO IXHO 7KH JHQHUDWRU HPLVVLRQV ZHUH PRGHOHG XVLQJ &DO((0RG$GGLWLRQDOO\WKHJHQHUDWRUVZRXOGKDYHWRPHHW%$$40'%$&7UHTXLUHPHQWVIRU ,&(QJLQH&RPSUHVVLRQ,JQLWLRQ6WDWLRQDU\(PHUJHQF\QRQ$JULFXOWXUDOQRQGLUHFWGULYHILUH SXPSVRXUFHV7KHVHLQFOXGHHPLVVLRQOLPLWVVLPLODUWR86(3$7LHUVWDQGDUGVIRUWKHHQJLQHV ODUJHUWKDQKS)RXURIWKHVL[JHQHUDWRUVDUHODUJHUWKDQKS Project Cooling Towers 7KHSURMHFWZRXOGLQFOXGHWZRFRROLQJWRZHUVWREHORFDWHGRQWKHWRSRIHDFKEXLOGLQJIRUDWRWDO RIVL[FRROLQJWRZHUV%DVHGRQLQIRUPDWLRQSURYLGHGE\WKHDSSOLFDQWHDFKFRROLQJWRZHUZRXOG KDYHDZDWHUIORZUDWHRIJDOORQVSHUPLQXWH*30XVLQJSXEOLFZDWHUZLWKDQDYHUDJHWRWDO GLVVROYHGVROLGV7'6RISDUWVSHUPLOOLRQSSPDQGDPLVWHOLPLQDWRUHIILFLHQF\RI SHUFHQW'HWDLOVRIWKHFRROLQJWRZHU30HPLVVLRQVFDOFXODWLRQVDUHSURYLGHGLQAttachment 3 Other Inputs 'HIDXOWPRGHODVVXPSWLRQVIRUHPLVVLRQVDVVRFLDWHGZLWKVROLGZDVWHJHQHUDWLRQXVHZHUHDSSOLHG WR WKH SURMHFW :DWHUZDVWHZDWHU XVH ZHUH FKDQJHG WR DHURELF FRQGLWLRQVWR UHSUHVHQW ZDVWHZDWHUWUHDWPHQWSODQWFRQGLWLRQVVLQFHWKHSURMHFWVLWHZRXOGQRWVHQGZDVWHZDWHUWRVHSWLF WDQNVRUIDFXOWDWLYHODJRRQV Existing Uses 7KHH[LVWLQJVLWHLVFXUUHQWO\GHYHORSHGZLWKWZRRQHVWRU\EXLOGLQJVDQGRQHWZRVWRU\EXLOGLQJ WRWDOLQJVTXDUHIHHWVIRIRIILFH5 'OLIHVFLHQFHXVHDQGDVVRFLDWHGSDUNLQJ7KH H[LVWLQJXVHVDUHSUHGLFWHGWRJHQHUDWHGDLO\WULSV$&DO((0RGUXQZDVGHYHORSHGIRUWKH H[LVWLQJXVHRIWKHVLWH$GGLWLRQDOO\WKHWULSJHQHUDWLRQLQIRUPDWLRQZDVSURYLGHGIRUWKHH[LVWLQJ XVHRIWKHVLWH 6XPPDU\RI&RPSXWHG2SHUDWLRQDO3HULRG(PLVVLRQV $QQXDOHPLVVLRQVZHUHSUHGLFWHGXVLQJ&DO((0RG7KHGDLO\HPLVVLRQVZHUHFDOFXODWHGDVVXPLQJ GD\VRIRSHUDWLRQ7DEOHVKRZVDYHUDJHGDLO\HPLVVLRQVRI52*12;WRWDO30DQGWRWDO 30GXULQJRSHUDWLRQRIWKHSURMHFW7KHRSHUDWLRQDOSHULRGHPLVVLRQVZRXOGQRWH[FHHGWKH %$$40'VLJQLILFDQFHWKUHVKROGV 7DEOH 2SHUDWLRQDO3HULRG(PLVVLRQVȱ 6FHQDULR52*12[3030 3URMHFW2SHUDWLRQDO(PLVVLRQVtons/year 3URMHFW*HQHUDWRU(PLVVLRQVtons/year 3URMHFW&RROLQJ7RZHU(PLVVLRQVtons/year) ([LVWLQJ8VH(PLVVLRQVtons/year 1HW7RWDO2SHUDWLRQDO(PLVVLRQV BAAQMD Thresholds (tons /year)10 tons 10 tons 15 tons 10 tons Exceed Thresholds?1R 1R 1R 1R Total (lbs./day) BAAQMD Thresholds (lbs./day)54lbs. 54lbs. 82lbs. 54lbs. Exceed Threshold?1R 1R 1R 1R 1RWHV$VVXPHVGD\RSHUDWLRQ ,PSDFW$,5 ([SRVHVHQVLWLYHUHFHSWRUVWRVXEVWDQWLDOSROOXWDQWFRQFHQWUDWLRQV" 3URMHFWLPSDFWVUHODWHGWRLQFUHDVHGFRPPXQLW\ULVNFDQRFFXUHLWKHUE\LQWURGXFLQJDQHZVRXUFH RI7$&VZLWKWKHSRWHQWLDOWRDGYHUVHO\DIIHFWH[LVWLQJVHQVLWLYHUHFHSWRUVLQWKHSURMHFWYLFLQLW\RU E\VLJQLILFDQWO\H[DFHUEDWLQJH[LVWLQJFXPXODWLYH7$&LPSDFWV7KLVSURMHFWZRXOGLQWURGXFHQHZ VRXUFHVRI7$&VGXULQJFRQVWUXFWLRQLHRQVLWHFRQVWUXFWLRQDQGWUXFNKDXOLQJHPLVVLRQVDQG RSHUDWLRQLHPRELOHVRXUFHVJHQHUDWRUVFRROLQJWRZHUV 00$,5EFRQWDLQHGLQWKH*HQHUDO3ODQ(,5DGGUHVVHVH[SRVXUHRIVHQVLWLYHUHFHSWRUVWR7$&V DQGDLUSROOXWLRQ8QGHUWKLVPLWLJDWLRQPHDVXUHSURMHFWVWKDWPD\UHVXOWLQ7$&HPLVVLRQVWKDW DUHORFDWHGZLWKLQIHHWRIDVHQVLWLYHUHFHSWRUVDUHUHTXLUHGWRSUHSDUHD+HDOWK5LVN $VVHVVPHQW+5$%DVHGRQWKHUHVXOWVRIWKH+5$WKH3URMHFWPD\EHUHTXLUHGWRLGHQWLI\DQG LPSOHPHQWPHDVXUHVVXFKDVDLUILOWUDWLRQV\VWHPVWRUHGXFHSRWHQWLDOH[SRVXUHWRSDUWLFXODWH PDWWHUFDUERQPRQR[LGHGLHVHOIXPHVDQGRWKHUSRWHQWLDOKHDOWKKD]DUGV0HDVXUHVLGHQWLILHGLQ WKH+5$DUHWREHLQFOXGHGLQWRWKHVLWHGHYHORSPHQWSODQDVDFRPSRQHQWRIDSURSRVHGSURMHFW 7KHUHDUHVHQVLWLYHUHFHSWRUVZLWKLQIHHWRIWKHSURMHFWVLWH3URMHFWFRQVWUXFWLRQDFWLYLW\ ZRXOGJHQHUDWHGXVWDQGHTXLSPHQWH[KDXVWWKDWZRXOGDIIHFWQHDUE\VHQVLWLYHUHFHSWRUV7KH SURMHFWZRXOGLQFOXGHWKHLQVWDOODWLRQRIVL[HPHUJHQF\JHQHUDWRUVSRZHUHGE\GLHVHOHQJLQHVDQG VL[FRROLQJWRZHUVWZRDWRSHDFKEXLOGLQJ7UDIILFJHQHUDWHGE\WKHSURMHFWZRXOGFRQVLVWRI PRVWO\ OLJKWGXW\ JDVROLQHSRZHUHG YHKLFOHV ZKLFK ZRXOG SURGXFH 7$& DQG DLU SROOXWDQW HPLVVLRQVLQWKHORFDODUHD 3URMHFWLPSDFWVWRH[LVWLQJVHQVLWLYHUHFHSWRUVZHUHDGGUHVVHGIRUWHPSRUDU\FRQVWUXFWLRQDFWLYLWLHV DQG ORQJWHUP RSHUDWLRQDO FRQGLWLRQV 7KHUH DUH DOVR VHYHUDO VRXUFHV RI H[LVWLQJ 7$&V DQG ORFDOL]HGDLUSROOXWDQWVLQWKHYLFLQLW\RIWKHSURMHFW7KHLPSDFWRIWKHH[LVWLQJVRXUFHVRI7$& ZDV DOVR DVVHVVHG LQ WHUPV RI GHVFULELQJ WKH FXPXODWLYH ULVN ZKLFK LQFOXGHV WKH SURMHFW FRQWULEXWLRQ &RPPXQLW\5LVN0HWKRGRORJ\ &RPPXQLW\ULVNLPSDFWVDUHDGGUHVVHGE\SUHGLFWLQJLQFUHDVHGOLIHWLPHFDQFHUULVNWKHLQFUHDVH LQDQQXDO30FRQFHQWUDWLRQVDQGFRPSXWLQJWKH+D]DUG,QGH[+,IRUQRQFDQFHUKHDOWKULVNV 7KHULVNLPSDFWVIURPWKHSURMHFWDUHWKHFRPELQDWLRQRIULVNVIURPFRQVWUXFWLRQDQGRSHUDWLRQ VRXUFHV7KHVHVRXUFHVLQFOXGHRQVLWHFRQVWUXFWLRQDFWLYLW\FRQVWUXFWLRQWUXFNKDXOLQJLQFUHDVHG WUDIILFIURPWKHSURMHFWDQGJHQHUDWRUDQGFRROLQJWRZHURSHUDWLRQ7RHYDOXDWHWKHLQFUHDVHG FDQFHUULVNVIURPWKHSURMHFWD\HDUH[SRVXUHSHULRGZDVXVHGSHU%$$40'JXLGDQFHZLWK WKHVHQVLWLYHUHFHSWRUVEHLQJH[SRVHGWRERWKSURMHFWFRQVWUXFWLRQDQGRSHUDWLRQHPLVVLRQVGXULQJ WKLVWLPHIUDPH 7KHSURMHFWLQFUHDVHGFDQFHUULVNLVFRPSXWHGE\VXPPLQJWKHSURMHFWFRQVWUXFWLRQFDQFHUULVNDQG RSHUDWLRQFDQFHUULVNFRQWULEXWLRQV8QOLNHWKHLQFUHDVHGPD[LPXPFDQFHUULVNWKHDQQXDO30 FRQFHQWUDWLRQDQG+,YDOXHVDUHQRWDGGLWLYHEXWEDVHGRQWKHDQQXDOPD[LPXPYDOXHVIRUWKH HQWLUHW\RIWKHSURMHFW7KHSURMHFWPD[LPDOO\H[SRVHGLQGLYLGXDO0(,LVLGHQWLILHGDVWKH VHQVLWLYHUHFHSWRUWKDWLVPRVWLPSDFWHGE\WKHSURMHFW¶VFRQVWUXFWLRQDQGRSHUDWLRQ 7KHPHWKRGRORJ\IRUFRPSXWLQJFRPPXQLW\ULVNVLPSDFWVLVFRQWDLQHGLQAttachment 17KLVLQYROYHG WKHFDOFXODWLRQRI7$&DQG30HPLVVLRQVGLVSHUVLRQPRGHOLQJRIWKHVHHPLVVLRQVDQGFRPSXWDWLRQV RIFDQFHUULVNDQGQRQFDQFHUKHDOWKHIIHFWV 0RGHOHG6HQVLWLYH5HFHSWRUV 5HFHSWRUVIRUWKLVDVVHVVPHQWLQFOXGHGORFDWLRQVZKHUHVHQVLWLYHSRSXODWLRQVZRXOGEHSUHVHQWIRU H[WHQGHGSHULRGVRIWLPHLHFKURQLFH[SRVXUHV7KLVLQFOXGHVWKH*DWHZD\&KLOG'HYHORSPHQW &HQWHU<0&$DQGWKHH[LVWLQJUHVLGHQFHVWRWKHZHVWRIWKHVLWHDVVKRZQLQ)LJXUH5HVLGHQWLDO UHFHSWRUVDUHDVVXPHGWRLQFOXGHDOOUHFHSWRUJURXSVLHWKLUGWULPHVWHULQIDQWVFKLOGUHQDQG DGXOWVZLWKDOPRVWFRQWLQXRXVH[SRVXUHWRSURMHFWHPLVVLRQV &RPPXQLW\+HDOWK5LVNIURP3URMHFW&RQVWUXFWLRQ &RQVWUXFWLRQHTXLSPHQWDQGDVVRFLDWHGKHDY\GXW\WUXFNWUDIILFJHQHUDWHVGLHVHOH[KDXVWZKLFKLV D NQRZQ 7$& 7KHVH H[KDXVW HPLVVLRQV SRVH KHDOWK ULVNV IRU VHQVLWLYH UHFHSWRUV VXFK DV VXUURXQGLQJUHVLGHQWV7KHSULPDU\FRPPXQLW\ULVNLPSDFWLVVXHVDVVRFLDWHGZLWKFRQVWUXFWLRQ HPLVVLRQVDUHFDQFHUULVNDQGH[SRVXUHWR30'LHVHOH[KDXVWSRVHVERWKDSRWHQWLDOKHDOWKDQG QXLVDQFHLPSDFWWRQHDUE\UHFHSWRUV$KHDOWKULVNDVVHVVPHQWRIWKHSURMHFWFRQVWUXFWLRQDFWLYLWLHV ZDV FRQGXFWHG WKDW HYDOXDWHG SRWHQWLDO KHDOWK HIIHFWV WR QHDUE\ VHQVLWLYH UHFHSWRUV IURP FRQVWUXFWLRQHPLVVLRQVRI'30DQG307KLVDVVHVVPHQWLQFOXGHGGLVSHUVLRQPRGHOLQJWR SUHGLFWWKHRIIVLWHFRQFHQWUDWLRQVUHVXOWLQJIURPSURMHFWFRQVWUXFWLRQVRWKDWOLIHWLPHFDQFHUULVNV DQGQRQFDQFHUKHDOWKHIIHFWVFRXOGEHHYDOXDWHG. 7KHWKUHHLGHQWLILHG7$&DQGDQQXDO30VRXUFHVDVVRFLDWHGZLWKWKHSURMHFWRQFHLQRSHUDWLRQ ZRXOGEHHPSOR\HHWULSVLQIUHTXHQWRSHUDWLRQRIVWDQGE\JHQHUDWRUVDVVXPHGWREHSRZHUHGE\ %$$40'BAAQMD Air Toxics NSR Program Health Risk Assessment (HRA) Guidelines'HFHPEHU '30LVLGHQWLILHGE\&DOLIRUQLDDVDWR[LFDLUFRQWDPLQDQWGXHWRWKHSRWHQWLDOWRFDXVHFDQFHU GLHVHOIXHODQGFRROLQJWRZHUV7UDIILFIURPWKHSURMHFWZRXOGEHPDGHXSRIPRVWO\JDVROLQH SRZHUHGYHKLFOHV Construction Emissions 7KH&DO((0RGPRGHODQG(0)$&HPLVVLRQVSURYLGHGWRWDODQQXDO30H[KDXVWHPLVVLRQV DVVXPHGWREH'30IRUWKHRIIURDGFRQVWUXFWLRQHTXLSPHQWDQGIRUH[KDXVWHPLVVLRQVIURPRQ URDGYHKLFOHVZLWKWRWDOHPLVVLRQVIURPDOOFRQVWUXFWLRQVWDJHVDVWRQVSRXQGV7KHRQ URDGHPLVVLRQVDUHDUHVXOWRIKDXOWUXFNWUDYHOGXULQJGHPROLWLRQDQGJUDGLQJDFWLYLWLHVZRUNHU WUDYHODQGYHQGRUGHOLYHULHVGXULQJFRQVWUXFWLRQ$WULSOHQJWKRIRQHPLOHZDVXVHGWRUHSUHVHQW YHKLFOHWUDYHOZKLOHDWRUQHDUWKHFRQVWUXFWLRQVLWH,WZDVDVVXPHGWKDWWKHVHHPLVVLRQVIURPRQ URDGYHKLFOHVWUDYHOLQJDWRUQHDUWKHVLWHZRXOGRFFXUDWWKHFRQVWUXFWLRQVLWH)XJLWLYH30GXVW HPLVVLRQVZHUHFDOFXODWHGE\&DO((0RGDVWRQVSRXQGVIRUWKHRYHUDOOFRQVWUXFWLRQ SHULRG 'LVSHUVLRQ0RGHOLQJ 7KH86(3$$(502'GLVSHUVLRQPRGHOZDVXVHGWRSUHGLFWFRQFHQWUDWLRQVRI'30DQG30 FRQFHQWUDWLRQVDWVHQVLWLYHUHFHSWRUVLQWKHYLFLQLW\RIWKHSURMHFWFRQVWUXFWLRQDUHD7KH$(502' GLVSHUVLRQPRGHOLVD%$$40'UHFRPPHQGHGPRGHOIRUXVHLQPRGHOLQJDQDO\VLVRIWKHVHW\SHV RI HPLVVLRQ DFWLYLWLHV IRU &(4$ SURMHFWV (PLVVLRQ VRXUFHV IRU WKH FRQVWUXFWLRQ VLWH ZHUH JURXSHGLQWRWZRFDWHJRULHVH[KDXVWHPLVVLRQVRI'30DQGIXJLWLYH30GXVWHPLVVLRQV &RQVWUXFWLRQ6RXUFHV &RPEXVWLRQHTXLSPHQW'30H[KDXVWHPLVVLRQVZHUHPRGHOHGDVDVHULHVRISRLQWVRXUFHVZLWKD QLQHIRRWUHOHDVHKHLJKWFRQVWUXFWLRQHTXLSPHQWH[KDXVWVWDFNKHLJKWSODFHGDWIHHWPHWHU LQWHUYDOVWKURXJKRXWWKHFRQVWUXFWLRQVLWH7KLVUHVXOWHGLQLQGLYLGXDOSRLQWVRXUFHVEHLQJ XVHGWRUHSUHVHQWPRELOHHTXLSPHQW'30H[KDXVWHPLVVLRQVLQWKHFRQVWUXFWLRQDUHDZLWK'30 HPLVVLRQVRFFXUULQJWKURXJKRXWWKHSURMHFWFRQVWUXFWLRQVLWH,QDGGLWLRQWKHIROORZLQJVWDFN SDUDPHWHUVZHUHXVHGDYHUWLFDOUHOHDVHDVWDFNGLDPHWHURILQFKHVDQH[KDXVWWHPSHUDWXUH RIÛ)DQGDQH[LWYHORFLW\RIIHHWSHUVHFRQG6LQFHWKHVHDUHSRLQWVRXUFHVSOXPHULVHLV FDOFXODWHGE\WKH$(502'GLVSHUVLRQPRGHO(PLVVLRQVIURPYHKLFOHWUDYHORQDQGRIIVLWH ZHUHDOVRGLVWULEXWHGDPRQJWKHSRLQWVRXUFHVWKURXJKRXWWKHVLWH7KHORFDWLRQVRIWKHSRLQW VRXUFHVXVHGIRUWKHPRGHOLQJDUHLGHQWLILHGLQ)LJXUH )RUPRGHOLQJIXJLWLYH30HPLVVLRQVDQHDUJURXQGOHYHOUHOHDVHKHLJKWRIIHHWPHWHUVZDV XVHGIRUWKHDUHDVRXUFH)XJLWLYHGXVWHPLVVLRQVDWFRQVWUXFWLRQVLWHVFRPHIURPDYDULHW\RI VRXUFHVLQFOXGLQJWUXFNDQGHTXLSPHQWWUDYHOJUDGLQJDFWLYLWLHVWUXFNORDGLQJZLWKORDGHUVDQG XQORDGLQJUHDURUERWWRPGXPSLQJORDGHUVDQGH[FDYDWRUVPRYLQJDQGWUDQVIHUULQJVRLODQGRWKHU PDWHULDOVHWF$OORIWKHVHDFWLYLWLHVUHVXOWLQIXJLWLYHGXVWHPLVVLRQVDWYDULRXVKHLJKWVDWWKH SRLQWVRIJHQHUDWLRQ2QFHJHQHUDWHGWKHGXVWSOXPHZLOOWHQGWRULVHDVLWPRYHVGRZQZLQG DFURVVWKHVLWHDQGH[LWWKHVLWHDWDKLJKHUHOHYDWLRQWKDQZKHQLWZDVJHQHUDWHG)RUDOOWKHVH UHDVRQVDIRRWUHOHDVHKHLJKWZDVXVHGDVWKHDYHUDJHUHOHDVHKHLJKWDFURVVWKHFRQVWUXFWLRQVLWH %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW%$$40'Recommended Methods for Screening and Modeling Local Risks and Hazards, Version 3.0. 0D\ (PLVVLRQVIURPWKHFRQVWUXFWLRQHTXLSPHQWDQGRQURDGYHKLFOHWUDYHOZHUHGLVWULEXWHGWKURXJKRXW WKHPRGHOHGDUHDVRXUFHV $(502',QSXWVDQG0HWHRURORJLFDO'DWD 7KHPRGHOLQJXVHGDILYH\HDUGDWDVHWRIKRXUO\PHWHRURORJLFDOGDWDIURPWKH6DQ )UDQFLVFR,QWHUQDWLRQDO$LUSRUWZDVXVHGZLWKWKH$(502'PRGHO&RQVWUXFWLRQHPLVVLRQVZHUH PRGHOHGDVRFFXUULQJGDLO\EHWZHHQDPWRSPZKHQWKHPDMRULW\RIFRQVWUXFWLRQ DFWLYLW\LVH[SHFWHGWRRFFXU$QQXDO'30DQG30FRQFHQWUDWLRQVIURPFRQVWUXFWLRQDFWLYLWLHV GXULQJWKHSHULRGZHUHFDOFXODWHGXVLQJWKHPRGHO'30DQG30FRQFHQWUDWLRQVZHUH FDOFXODWHGDWQHDUE\VHQVLWLYHUHFHSWRUV5HFHSWRUKHLJKWVRIIHHWPHWHUVDQGIHHW PHWHUVZHUHXVHGWRUHSUHVHQWWKHEUHDWKLQJKHLJKWRQWKHILUVWDQGVHFRQGIORRURIQHDUE\ UHVLGHQFHV$UHFHSWRUKHLJKWRIIHHWPHWHUZDVXVHGWRUHSUHVHQWEUHDWKLQJKHLJKWRI FKLOGUHQDWWKH*DWHZD\&KLOG'HYHORSPHQW&HQWHU<0&$ 6XPPDU\RI&RQVWUXFWLRQ&RPPXQLW\5LVN,PSDFWV 7KHPD[LPXPLQFUHDVHGFDQFHUULVNVZHUHFDOFXODWHGXVLQJWKHPRGHOHG7$&FRQFHQWUDWLRQV FRPELQHGZLWKWKH2IILFHRI(QYLURQPHQWDO+HDOWK+D]DUG$VVHVVPHQW2(++$JXLGDQFHIRU DJHVHQVLWLYLW\IDFWRUVDQGH[SRVXUHSDUDPHWHUVDVUHFRPPHQGHGE\%$$40'VHHAttachment 1) 1RQFDQFHU KHDOWK KD]DUGV DQG PD[LPXP 30 FRQFHQWUDWLRQV ZHUH DOVR FDOFXODWHG DQG LGHQWLILHG$JHVHQVLWLYLW\IDFWRUVUHIOHFWWKHJUHDWHUVHQVLWLYLW\RILQIDQWVDQGVPDOOFKLOGUHQWR FDQFHUFDXVLQJ7$&V,QIDQWFKLOGDQGDGXOWH[SRVXUHVZHUHDVVXPHGWRRFFXUDWDOOUHVLGHQFHV GXULQJWKHHQWLUHFRQVWUXFWLRQSHULRG 7KHPD[LPXPPRGHOHGDQQXDO30FRQFHQWUDWLRQZDVFDOFXODWHGEDVHGRQFRPELQHGH[KDXVWDQG IXJLWLYHFRQFHQWUDWLRQV7KHPD[LPXPFRPSXWHG+,YDOXHZDVEDVHGRQWKHUDWLRRIWKHPD[LPXP '30FRQFHQWUDWLRQPRGHOHGDQGWKHFKURQLFLQKDODWLRQUHIHQFHH[SRVXUHOHYHORIJP 7KHPD[LPXPPRGHOHGDQQXDO'30DQG30FRQFHQWUDWLRQVZKLFKLQFOXGHVERWKWKH'30DQG IXJLWLYH30FRQFHQWUDWLRQVZHUHLGHQWLILHGDWQHDUE\VHQVLWLYHUHFHSWRUVDVVKRZQLQ)LJXUH WRILQGWKHPD[LPDOO\H[SRVHGLQGLYLGXDOV0(,5HVXOWVRIWKLVDVVHVVPHQWLQGLFDWHGWKDWWKH FRQVWUXFWLRQUHVLGHQWLDO0(,ZDVORFDWHGRQWKHILUVWIORRUIHHWDERYHJURXQGRIWKH*DWHZD\ &KLOG 'HYHORSPHQW &HQWHU <0&$ 7DEOH VXPPDUL]HV WKH PD[LPXP FDQFHU ULVNV 30 FRQFHQWUDWLRQVDQGKHDOWKKD]DUGLQGH[HVIRUSURMHFWUHODWHGFRQVWUXFWLRQDFWLYLWLHVDIIHFWLQJWKH FRQVWUXFWLRQ0(,Attachment 4WRWKLVUHSRUWLQFOXGHVWKHHPLVVLRQFDOFXODWLRQVXVHGIRUWKH FRQVWUXFWLRQDUHDVRXUFHPRGHOLQJDQGWKHFDQFHUULVNFDOFXODWLRQV %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW5HFRPPHQGHG0HWKRGVIRU6FUHHQLQJDQG0RGHOLQJ/RFDO 5LVNVDQG+D]DUGV9HUVLRQ0D\:HEKWWSVZZZEDDTPGJRYaPHGLDILOHVSODQQLQJDQG UHVHDUFKFHTDULVNPRGHOLQJDSSURDFKPD\SGI"OD HQ )LJXUH /RFDWLRQRI3URMHFW&RQVWUXFWLRQ6LWH3URMHFW3RLQW6RXUFHV3URMHFW *HQHUDWRU3URMHFW&RROLQJ7RZHUV3URMHFW7ULSV0RGHO2II6LWH6HQVLWLYH 5HFHSWRUVDQG0D[LPXP7$&,PSDFW &RPPXQLW\5LVNVIURP3URMHFW2SHUDWLRQ 2SHUDWLRQRIWKHSURMHFWZRXOGKDYHORQJWHUPHPLVVLRQVIURPPRELOHVRXUFHVLHWUDIILF HPHUJHQF\JHQHUDWRUVDQGFRROLQJWRZHUV:KLOHWKHVHHPLVVLRQVZRXOGQRWEHDVLQWHQVLYHDWRU QHDUWKHVLWHDVFRQVWUXFWLRQDFWLYLW\WKH\ZRXOGFRQWULEXWHWRORQJWHUPHIIHFWVWRVHQVLWLYH UHFHSWRUV 3URMHFW7UDIILF 'LHVHOSRZHUHGYHKLFOHVDUHWKHSULPDU\FRQFHUQZLWKORFDOWUDIILFJHQHUDWHG7$&LPSDFWV7KLV SURMHFWZRXOGJHQHUDWHDQHWRIGDLO\WULSVZLWKDPDMRULW\RIWKHWULSVEHLQJIURPOLJKW GXW\JDVROLQHSRZHUHGYHKLFOHVLHSDVVHQJHUFDUV7KHSURMHFWLVQRWDQWLFLSDWHGWRJHQHUDWH ODUJHDPRXQWVRIWUXFNWULSVWKDWZRXOGLQYROYHGLHVHOYHKLFOHV7KHVHWULSVZHUHPRGHOHGWRRFFXU RQ'XEXTXH$YHQXH7KLVDQDO\VLVLQYROYHGWKHGHYHORSPHQWRI'30RUJDQLF7$&VDQG30 (PDLOIURP5HEHFFD$XOG6HSWHPEHU HPLVVLRQV IRU SURMHFW WULSV RQ 'XEXTXH $YHQXH XVLQJ WKH &DOWUDQV YHUVLRQ RI WKH &$5% (0)$&HPLVVLRQVPRGHONQRZQDV&7(0)$&&7(0)$&SURYLGHVDJJUHJDWH HPLVVLRQ IDFWRUV LQ IRU GLVSHUVLRQ PRGHOLQJ RI PRELOH VRXUFH FULWHULD SROOXWDQWV DQG 7$&V LQFOXGLQJ'30(PLVVLRQSURFHVVHVPRGHOHGLQFOXGHUXQQLQJH[KDXVWIRU'3030DQGWRWDO RUJDQLFFRPSRXQGV72*UXQQLQJHYDSRUDWLYHORVVHVIRU72*DQGWLUHDQGEUDNHZHDUDQG IXJLWLYHURDGGXVWIRU30'30 HPLVVLRQV DUH SURMHFWHG WR GHFUHDVH LQWKH IXWXUHDQGDUH UHIOHFWHGLQWKH&7(0)$&HPLVVLRQVGDWD,QSXWVWRWKHPRGHOLQFOXGHUHJLRQ6DQ0DWHR &RXQW\W\SHRIURDGPDMRUFROOHFWRU\HDURIDQDO\VLV±RSHUDWLRQDO\HDUORFDOWUXFNPL[ IRU6DQ0DWHR&RXQW\SHUFHQWDQGVHDVRQDQQXDO )RUDOOKRXUVRIWKHGD\DQDYHUDJHVSHHGRIPSKRQ'XEXTXH$YHQXHZDVDVVXPHGIRUDOO YHKLFOHVEDVHGRQSRVWHGVSHHGOLPLWVLJQVRQWKHURDGZD\V'LVSHUVLRQPRGHOLQJRI7$&DQG 30 HPLVVLRQV ZDV FRQGXFWHG XVLQJ WKH 86 (3$ $(502' GLVSHUVLRQ PRGHO ZKLFK LV UHFRPPHQGHGE\WKH%$$40'IRUWKLVW\SHRIDQDO\VLV7$&DQG30HPLVVLRQVIURPSURMHFW WULSVZLWKLQDERXWIHHWRIWKHSURMHFWVLWHZHUHHYDOXDWHGZLWKWKHPRGHO(PLVVLRQVIURP SURMHFWWULSVZHUHPRGHOHGLQ$(502'XVLQJDVHULHVRIYROXPHVRXUFHVDORQJDOLQHOLQHYROXPH VRXUFHVZLWKOLQHVHJPHQWVXVHGWRUHSUHVHQWRSSRVLQJWUDYHOODQHVRQ'XEXTXH$YHQXH7KH VDPH PHWHRURORJLFDO GDWD DQG RIIVLWH VHQVLWLYH UHFHSWRUV XVHGLQ WKH SUHYLRXV FRQVWUXFWLRQ GLVSHUVLRQPRGHOLQJZHUHXVHGLQWKHURDGZD\PRGHOLQJ2WKHULQSXWVWRWKHPRGHOLQFOXGHGURDG JHRPHWU\KRXUO\WUDIILFHPLVVLRQVDQGUHFHSWRUORFDWLRQVDQGKHLJKWV$QQXDO7$&DQG30 FRQFHQWUDWLRQVIRURQWKHKDXOURXWHZHUHFDOFXODWHGXVLQJWKHPRGHO&RQFHQWUDWLRQVZHUH FDOFXODWHGDWWKHSURMHFW0(, 3URMHFW*HQHUDWRUV $VGLVFXVVHGDERYHLQWKH2SHUDWLRQDO3HULRG(PLVVLRQVVHFWLRQWKHSURMHFWZRXOGLQFOXGHVL[ JHQHUDWRUV2SHUDWLRQRIDGLHVHOJHQHUDWRUZRXOGEHDVRXUFHRI7$&HPLVVLRQV7KHJHQHUDWRUV ZRXOGEHRSHUDWHGIRUWHVWLQJDQGPDLQWHQDQFHSXUSRVHVZLWKDPD[LPXPRIKRXUVSHU\HDURI QRQHPHUJHQF\RSHUDWLRQXQGHUQRUPDOFRQGLWLRQV'XULQJWHVWLQJSHULRGVWKHHQJLQHZRXOG W\SLFDOO\EHUXQIRUOHVVWKDQRQHKRXUXQGHUOLJKWHQJLQHORDGV7KHJHQHUDWRUHQJLQHVZRXOGEH UHTXLUHGWRPHHW(3$HPLVVLRQVWDQGDUGVDQGFRQVXPHFRPPHUFLDOO\DYDLODEOHORZVXOIXUGLHVHO IXHO$GGLWLRQDOO\WKHJHQHUDWRUVZRXOGKDYHWRPHHW%$$40'%$&7UHTXLUHPHQWVIRU,& (QJLQH&RPSUHVVLRQ ,JQLWLRQ 6WDWLRQDU\ (PHUJHQF\ QRQ$JULFXOWXUDO QRQGLUHFW GULYH ILUH SXPSVRXUFHV%DVHGRQWKHVL]HRIWKHSURSRVHGJHQHUDWRUWKHVHLQFOXGHHPLVVLRQOLPLWVVLPLODU WR86(3$7LHUHQJLQHV7KHHPLVVLRQVIURPWKHRSHUDWLRQRIWKHJHQHUDWRUVZHUHFDOFXODWHG XVLQJWKH&DO((0RGPRGHO 7KHVHGLHVHOHQJLQHVZRXOGEHVXEMHFWWR&$5%¶V6WDWLRQDU\'LHVHO$LUERUQH7R[LFV&RQWURO 0HDVXUH$7&0DQGUHTXLUHSHUPLWVIURPWKH%$$40'VLQFHLWZLOOEHHTXLSSHGZLWKDQ HQJLQHODUJHUWKDQ+3%$&7UHTXLUHPHQWVZRXOGDSSO\WRWKHVHJHQHUDWRUVWKDWZRXOGOLPLW '30HPLVVLRQV$VSDUWRIWKH%$$40'SHUPLWUHTXLUHPHQWVIRUWR[LFVVFUHHQLQJDQDO\VLVWKH HQJLQHHPLVVLRQVZLOOKDYHWRPHHW%HVW$YDLODEOH&RQWURO7HFKQRORJ\IRU7R[LFV%$&7DQG %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFWRecommended Methods for Screening and Modeling Local Risks and Hazards, Version 3.0. 0D\:HEKWWSVZZZEDDTPGJRYaPHGLDILOHVSODQQLQJDQG UHVHDUFKFHTDULVNPRGHOLQJDSSURDFKPD\SGI"OD HQ %$$40'Recommended Methods for Screening and Modeling Local Risks and Hazards0D\ SDVVWKHWR[LFULVNVFUHHQLQJOHYHORIOHVVWKDQWHQLQDPLOOLRQ7KHULVNDVVHVVPHQWZRXOGEH SUHSDUHGE\%$$40''HSHQGLQJRQUHVXOWV%$$40'ZRXOGVHWOLPLWVIRU'30HPLVVLRQV HJPRUHUHVWULFWHGHQJLQHRSHUDWLRQSHULRGV6RXUFHVRIDLUSROOXWDQWHPLVVLRQVFRPSO\LQJZLWK DOODSSOLFDEOH%$$40'UHJXODWLRQVJHQHUDOO\ZLOOQRWEHFRQVLGHUHGWRKDYHDVLJQLILFDQWDLU TXDOLW\FRPPXQLW\ULVNLPSDFW 7RREWDLQDQHVWLPDWHRISRWHQWLDOFDQFHUULVNVDQG30LPSDFWVIURPRSHUDWLRQRIWKHHPHUJHQF\ JHQHUDWRUVDWWKHSURMHFW0(,WKH86(3$$(502'GLVSHUVLRQPRGHOZDVXVHGWRFDOFXODWHWKH PD[LPXP DQQXDO '30 FRQFHQWUDWLRQ DW RIIVLWH VHQVLWLYH UHFHSWRU ORFDWLRQV QHDUE\ FKLOGFDUHVFKRRODQGUHVLGHQFHV7KHVDPHUHFHSWRUVEUHDWKLQJKHLJKWVDQG%$$40'6DQ )UDQFLVFR,QWHUQDWLRQDO$LUSRUWPHWHRURORJLFDOGDWDXVHGLQWKHFRQVWUXFWLRQGLVSHUVLRQPRGHOLQJ ZHUHXVHGIRUWKHJHQHUDWRUPRGHOV6WDFNSDUDPHWHUVIRUPRGHOLQJWKHJHQHUDWRUVZHUHEDVHGRQ %$$40'GHIDXOWSDUDPHWHUVLHH[KDXVWJDVIORZUDWHVWDFNGLDPHWHUVWDFNKHLJKWDQGH[KDXVW JDVWHPSHUDWXUHIRUVWDQGE\GLHVHOJHQHUDWRUV$QQXDODYHUDJH'30DQG30FRQFHQWUDWLRQV ZHUHPRGHOHGDVVXPLQJWKDWJHQHUDWRUWHVWLQJFRXOGRFFXUDWDQ\WLPHRIWKHGD\KRXUVSHU GD\GD\VSHU\HDU 3URMHFW&RROLQJ7RZHUV 7KHSURMHFWZRXOGLQFOXGHWZRFRROLQJWRZHUVRQWKHURRIRIHDFKEXLOGLQJIRUDWRWDORIVL[FRROLQJ WRZHUV 3DUWLFXODWH PDWWHU HPLVVLRQV IURP HYDSRUDWLYH FRROLQJ FDQ RFFXU DQG DUH D UHVXOW RI HYDSRUDWLRQRIOLTXLGZDWHUHQWUDLQHGLQWKHGLVFKDUJHDLUVWUHDPDQGFDUULHGRXWRIWKHWRZHUDV ³GULIW´GURSOHWVWKDWFRQWDLQGLVVROYHGVROLGVLQWKHZDWHU'ULIWGURSOHWVWKDWHYDSRUDWHFDQSURGXFH VPDOOSDUWLFXODWHPDWWHULH30DQG30HPLVVLRQV7KHVHHPLVVLRQVDUHJHQHUDWHGZKHQWKH GULIWGURSOHWVHYDSRUDWHDQGOHDYHWKHSDUWLFXODWHPDWWHUIRUPHGE\FU\VWDOOL]DWLRQRIGLVVROYHG VROLGV7KHFRROLQJWRZHUVDUHQRWDVRXUFHRIFRPEXVWLRQHPLVVLRQVWKDWPD\FRQWDLQ7$&V )RUWKHKHDOWKULVNDVVHVVPHQWWKH30HPLVVLRQVIURPHYDSRUDWLYHFRROLQJZHUHFDOFXODWHG EDVHGRQDZRUVWFDVHDVVXPSWLRQVLQFOXGLQJXVHRIHYDSRUDWLYHFRROLQJIRUSHUFHQWRIWKH WLPHDZDWHUIORZUDWHRIJDOORQVSHUPLQXWHJSPXVHRISHUFHQWGULIWHOLPLQDWRUVD WRWDOGLVVROYHGVROLGV7'6FRQFHQWUDWLRQRISDUWVSHUPLOOLRQSSPLQWKHUHFLUFXODWLQJ ZDWHU%DVHGRQDFDOFXODWHGWRWDOGULIWUDWHUHFLUFXODWLQJZDWHU7'6FRQFHQWUDWLRQRISSP DQG30IUDFWLRQVEDVHGRQ6&$40'WKH30HPLVVLRQVZHUHFDOFXODWHGDVWRQVSHU \HDUSHUFRROLQJWRZHU 7RREWDLQDQHVWLPDWHRISRWHQWLDO30FRQFHQWUDWLRQVIURPRSHUDWLRQRIWKHFRROLQJWRZHUVWKH 86(3$$(502'GLVSHUVLRQPRGHOZDVXVHGWRFDOFXODWHWKHDQQXDO30FRQFHQWUDWLRQDW %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFW6DQ)UDQFLVFR'HSDUWPHQWRI3XEOLF+HDOWKDQG6DQ)UDQFLVFR 3ODQQLQJ'HSDUWPHQWThe San Francisco Community Risk Reduction Plan: Technical Support Document, %$$40''HFHPEHU:HE KWWSVZZZJVZHYHQWFHQWHUFRP$SSHDOB5HVSRQVHB5HIHUHQFHVBB%$$40'SGI 5HFLUFXODWLQJZDWHUIORZUDWHDQGPD[LPXP7'6FRQFHQWUDWLRQEDVHGRQ6RXWK6DQ)UDQFLVFR:DWHU 4XDOLW\5HSRUW7'65DQJH0D[85/KWWSVZZZFDOZDWHUFRPFFUVED\VVI 6RXWK&RDVW$40'Final-Methodology to Calculate Particulate Matter (PM) 2.5 and PM2.5 Significance Thresholds, Appendix A2FWREHU:HEKWWSZZZDTPGJRYGRFVGHIDXOWVRXUFHFHTDKDQGERRNORFDOL]HG VLJQLILFDQFHWKUHVKROGVSDUWLFXODWHPDWWHUSPVLJQLILFDQFHWKUHVKROGVDQGFDOFXODWLRQ PHWKRGRORJ\ILQDOBSPBPHWKRGRORJ\SGI RIIVLWHVHQVLWLYHUHFHSWRUORFDWLRQV7KHVDPHUHFHSWRUVEUHDWKLQJKHLJKWVDQG%$$40'6DQ )UDQFLVFR,QWHUQDWLRQDO$LUSRUWPHWHRURORJLFDOGDWDXVHGLQWKHFRQVWUXFWLRQGLVSHUVLRQPRGHOLQJ ZHUHXVHGIRUWKHFRROLQJWRZHUPRGHOV9ROXPHVRXUFHSDUDPHWHUVIRUPRGHOLQJWKHFRROLQJWRZHU ZHUHEDVHGRQSURMHFWVSHFLILFFRROLQJWRZHUSDUDPHWHUVLHOHQJWKRIVLGHUHOHDVHKHLJKW HPLVVLRQUDWHIORZUDWH7'6PLVWHOLPLQDWRUHIILFLHQF\$QQXDO30FRQFHQWUDWLRQVZHUH PRGHOHGDVVXPLQJWKDWFRROLQJWRZHUZRXOGRSHUDWHDWDQ\WLPHRIWKHGD\KRXUVSHUGD\ GD\VSHU\HDU 7KH DQQXDO 30 FRQFHQWUDWLRQ ZHUH EDVHG RQ DQ DQQXDO PD[LPXP ULVN 7DEOH OLVWV WKH FRPPXQLW\ULVNVIURPFRROLQJWRZHUVDWWKHORFDWLRQRIFKLOGFDUH0(,DQGUHVLGHQWLDOPD[LPXP UHFHSWRU 7KH SDUWLFXODWH PDWWHU HPLVVLRQV IRU WKH SURSRVHG FRROLQJ WRZHUV DUH LQFOXGHG LQ Attachment 5 3URMHFW/DERUDWRULHV 7KLVW\SHRISURMHFWPD\LQFOXGHUHVHDUFKDQGPDQXIDFWXULQJW\SHODERUDWRULHV6LQFHDVSHFLILF XVHURUW\SHRIODEXVHLVQRWNQRZQDWWKLVWLPHLWLVQRWSRVVLEOHWRSUHGLFWZKHWKHUWKHUHZRXOG EHDQ\7$&HPLVVLRQVDQGLIVRWKHTXDQWLWLHVWKDWZRXOGEHHPLWWHG7\SLFDOO\ODERUDWRU\XVHV KDYHIXPHKRRGVDQGZRXOGHPSOR\DSSURSULDWHH[KDXVWV\VWHPVWRFRQWURODQ\HPLVVLRQRIDLU SROOXWDQWV(PLVVLRQVRIDLUSROOXWDQWVRU7$&VDUHVXEMHFWWR%$$40'SHUPLWWLQJUHTXLUHPHQWV WKDWZRXOGUHTXLUHWKH'LVWULFWWRDSSO\DOODSSOLFDEOHUXOHVDQGUHJXODWLRQVWROLPLWRUFRQWUROWKHVH HPLVVLRQV5HJXODWLRQ5XOH*HQHUDO5HTXLUHPHQWVDQG5HJXODWLRQ5XOH1HZ6RXUFH 5HYLHZRI7R[LF$LU&RQWDPLQDQWVZRXOGDSSO\WRDQ\SRWHQWLDOHPLVVLRQVIURPWKHVHVRXUFHV 7KH'LVWULFW¶VULVNSROLF\LVWRQRWLVVXHDSHUPLWWRDQ\VRXUFHWKDWZRXOGFDXVHDFDQFHUULVNRI JUHDWHUWKDQFKDQFHVSHUPLOOLRQ 6XPPDU\RI3URMHFW5HODWHG&RPPXQLW\5LVNVDWWKH2IIVLWH3URMHFW0(, 7KHFXPXODWLYHULVNLPSDFWVIURPDSURMHFWDUHWKHFRPELQDWLRQRIFRQVWUXFWLRQDQGRSHUDWLRQ VRXUFHV)RUWKLVSURMHFWWKHVHVRXUFHVLQFOXGHWKHRQVLWHFRQVWUXFWLRQDFWLYLW\JHQHUDWRUV FRROLQJWRZHUVDQGRSHUDWLRQDOYHKLFOHWULSV7KHSURMHFWLPSDFWLVFRPSXWHGE\DGGLQJWKH FRQVWUXFWLRQFDQFHUULVNIRUDQLQIDQWWRWKHLQFUHDVHGFDQFHUULVNIRUWKHSURMHFWRSHUDWLRQDO FRQGLWLRQVIRUWKHJHQHUDWRUDQGYHKLFOHWULSVDWWKH0(,RYHUD\HDUSHULRG7KHSURMHFW0(, LVLGHQWLILHGDVWKHVHQVLWLYHUHFHSWRUWKDWLVPRVWLPSDFWHGE\WKHSURMHFW¶VFRQVWUXFWLRQDQG RSHUDWLRQ )RUWKLVSURMHFWWKHVHQVLWLYHUHFHSWRULGHQWLILHGLQ)LJXUHDVWKHFRQVWUXFWLRQ0(,LVDOVRWKH SURMHFW0(,$WWKLVORFDWLRQWKH0(,ZRXOGEHH[SRVHGWR\HDUVRIFRQVWUXFWLRQFDQFHUULVNV DQG\HDUVRIRSHUDWLRQDOFDQFHUULVNV8QOLNHWKHLQFUHDVHGPD[LPXPFDQFHUULVNWKHDQQXDO 30FRQFHQWUDWLRQDQG+,ULVNVDUHQRWDGGLWLYHEXWEDVHGRQDQDQQXDOPD[LPXPULVNIRUWKH HQWLUHW\RIWKHSURMHFW 3URMHFWULVNLPSDFWVDUHVKRZQLQ7DEOH7KHXQPLWLJDWHGPD[LPXPFDQFHUULVNVDQQXDO30 FRQFHQWUDWLRQDQG+D]DUG,QGH[IURPFRQVWUXFWLRQDFWLYLWLHVDWWKHUHVLGHQWLDOSURMHFW0(, ORFDWLRQZRXOGQRWH[FHHGWKHVLQJOHVRXUFHVLJQLILFDQFHWKUHVKROGV 7DEOH &RQVWUXFWLRQ5LVN,PSDFWVDWWKH2IIVLWH0(, 6RXUFH&DQFHU5LVN SHUPLOOLRQ $QQXDO30 JP +D]DUG ,QGH[ 3URMHFW&RQVWUXFWLRQ<HDUV±8QPLWLJDWHG 0LWLJDWHG 3URMHFW*HQHUDWRUV<HDUV± 3URMHFW&RROLQJ7RZHUV<HDUV± 3URMHFW2SHUDWLRQDO7ULSV<HDUV± 7RWDO0D[LPXP3URMHFW,PSDFWV<HDUV±8QPLWLJDWHG 0LWLJDWHG BAAQMD Single-Source Threshold6.01 0.31.0 Exceed Threshold? 8QPLWLJDWHG 0LWLJDWHG Yes No No No No No 3URMHFWVLWHDQGUHFHSWRUVDUHORFDWHGLQDQRYHUEXUGHQHGFRPPXQLW\DVGHILQHGE\%$$40' 1RWH5LVNVLQWKLVDUHUHSRUWHGIRUWKHPD[LPDOO\H[SRVHGLQGLYLGXDO0(,IDFWRULQJLQDJHVHQVLWLYLW\DWDOO UHFHSWRUVDQGUHSUHVHQWLQFUHDVHGOLIHWLPHULVN6HH$WWDFKPHQW$IRUDGGLWLRQDOGHWDLOV &XPXODWLYH&RPPXQLW\5LVNVRIDOO7$&6RXUFHVDWWKH2IIVLWH3URMHFW0(, &RPPXQLW\KHDOWKULVNDVVHVVPHQWVW\SLFDOO\ORRNDWDOOVXEVWDQWLDOVRXUFHVRI7$&VWKDWFDQDIIHFW VHQVLWLYHUHFHSWRUVWKDWDUHORFDWHGZLWKLQIHHWRIDSURMHFWVLWHLHLQIOXHQFHDUHD7KHVH VRXUFHVLQFOXGHUDLOOLQHVKLJKZD\VEXV\VXUIDFHVWUHHWVDQGVWDWLRQDU\VRXUFHVLGHQWLILHGE\ %$$40' $UHYLHZRIWKHSURMHFWDUHDEDVHGRQSURYLGHGWUDIILFLQIRUPDWLRQLQGLFDWHGWKDWWUDIILFRQ86 +LJKZD\$LUSRUW%RXOHYDUGDQG'XEXTXH$YHQXHZRXOGH[FHHGYHKLFOHVSHUGD\ 2WKHUQHDUE\VWUHHWVZRXOGKDYHOHVVWKDQYHKLFOHVSHUGD\$UHYLHZRI%$$40'¶V KLJKZD\DQGUDLOZD\UDVWHUGDWDLGHQWLILHGfrom RQHUDLOZD\ZLWKWKHSRWHQWLDOWRDIIHFWWKH SURMHFW0(,$UHYLHZRI%$$40'¶VVWDWLRQDU\VRXUFHPDSZHEVLWHLGHQWLILHGHOHYHQ VWDWLRQDU\VRXUFHVZLWKWKHSRWHQWLDOWRDIIHFWWKHSURMHFW0(,)LJXUHVKRZVWKHORFDWLRQRIWKH VRXUFHVDIIHFWLQJWKH0(,&RPPXQLW\ULVNLPSDFWVWKHVHVRXUFHVXSRQWKH0(,DUHUHSRUWHGLQ 7DEOH'HWDLOVRIWKHPRGHOLQJDQGFRPPXQLW\ULVNFDOFXODWLRQVDUHLQFOXGHGLQAttachment 5. )LJXUH 3URMHFW6LWHDQG1HDUE\7$&DQG306RXUFHV +LJKZD\V 5DLOZD\V±86+LJKZD\&DO7UDLQ=RQH 7KHSURMHFW0(,LVDSSUR[LPDWHO\IHHWVRXWKHDVWRI86+LJKZD\DQG&DO7UDLQ=RQH ERUGHUVWKHSURMHFWRQWKHVRXWKHDVWVLGH$UHILQHGDQDO\VLVRIWKHLPSDFWVRI7$&VDQG30WR WKH0(,UHFHSWRULVQHFHVVDU\WRHYDOXDWHSRWHQWLDOFDQFHUULVNVDQG30FRQFHQWUDWLRQVIURP +LJKZD\$UHYLHZRIWKHWUDIILFLQIRUPDWLRQUHSRUWHGE\&DOWUDQVLQGLFDWHVWKDW+LJKZD\ WUDIILFLQFOXGHVYHKLFOHVSHUGD\EDVHGRQDQDQQXDODYHUDJHWKDWDUHDERXWSHUFHQW WUXFNVRIZKLFKSHUFHQWDUHFRQVLGHUHGGLHVHOKHDY\GXW\WUXFNVDQGSHUFHQWDUHPHGLXP GXW\WUXFNV /RFDO5RDGZD\V±$LUSRUW%RXOHYDUGDQG'XEXTXH$YHQXH $UHILQHGDQDO\VLVRISRWHQWLDOKHDOWKLPSDFWVIURPYHKLFOHWUDIILFRQ$LUSRUW%RXOHYDUGDQG 'XEXTXH$YHQXHZDVFRQGXFWHG7KHUHILQHGDQDO\VLVLQYROYHGSUHGLFWLQJHPLVVLRQVIRUWKHWUDIILF YROXPHDQGPL[RIYHKLFOHW\SHVRQWKHURDGZD\QHDUWKHSURMHFWVLWHDQGXVLQJDQDWPRVSKHULF GLVSHUVLRQPRGHOWRSUHGLFWH[SRVXUHWR7$&V7KHDVVRFLDWHGFDQFHUULVNVDUHWKHQFRPSXWHG &DOWUDQV2020 Traffic Volumes California State Highways. &DOWUDQV2020 Annual Average Daily Truck Traffic on the California State Highway System. EDVHGRQWKHPRGHOHGH[SRVXUHVAttachment 1LQFOXGHVDGHVFULSWLRQRIKRZFRPPXQLW\ULVN LPSDFWVLQFOXGLQJFDQFHUULVNDUHFRPSXWHG Traffic Emissions Modeling 7KLVDQDO\VLVLQYROYHGWKHGHYHORSPHQWRI'30RUJDQLF7$&VDQG30HPLVVLRQVIRUWUDIILF RQ+LJKZD\$LUSRUW%RXOHYDUGDQG'XEXTXH$YHQXHXVLQJWKH&DOWUDQVYHUVLRQRIWKH &$5%(0)$&HPLVVLRQVPRGHONQRZQDV&7(0)$&&7(0)$&SURYLGHV HPLVVLRQIDFWRUVIRUPRELOHVRXUFHFULWHULDSROOXWDQWVDQG7$&VLQFOXGLQJ'30(PLVVLRQ SURFHVVHVPRGHOHGLQFOXGHUXQQLQJH[KDXVWIRU'3030DQGWRWDORUJDQLFFRPSRXQGV 72*UXQQLQJHYDSRUDWLYHORVVHVIRU72*DQGWLUHDQGEUDNHZHDUDQGIXJLWLYHURDGGXVWIRU 30$OO30HPLVVLRQVIURPDOOYHKLFOHVZHUHXVHGUDWKHUWKDQMXVWWKH30IUDFWLRQIURP GLHVHOSRZHUHGYHKLFOHVEHFDXVHDOOYHKLFOHW\SHVLHJDVROLQHDQGGLHVHOSRZHUHGSURGXFH 30$GGLWLRQDOO\30HPLVVLRQVIURPYHKLFOHWLUHDQGEUDNHZHDUIURPUHHQWUDLQHG URDGZD\GXVWZHUHLQFOXGHGLQWKHVHHPLVVLRQV'30HPLVVLRQVDUHSURMHFWHGWRGHFUHDVHLQWKH IXWXUHDQGDUHUHIOHFWHGLQWKH&7(0)$&HPLVVLRQVGDWD,QSXWVWRWKHPRGHOLQFOXGH UHJLRQ6DQ0DWHR&RXQW\W\SHRIURDGIUHHZD\DQGPDMRUFROOHFWRUWUDIILFPL[DVVLJQHGE\ &7(0)$&IRUWKHFRXQW\DGMXVWHGIRUWKHORFDOWUXFNPL[RQ+LJKZD\DQGWUXFN SHUFHQWDJHIRUQRQVWDWHKLJKZD\VLQ6DQ0DWHR&RXQW\SHUFHQWIRUWKHORFDOURDGZD\V \HDURIDQDO\VLV±FRQVWUXFWLRQVWDUW\HDUDQGVHDVRQDQQXDO 7RHVWLPDWH7$&DQG30HPLVVLRQVRYHUWKH\HDUH[SRVXUHSHULRGXVHGIRUFDOFXODWLQJWKH LQFUHDVHGFDQFHUULVNVIRUVHQVLWLYHUHFHSWRUVDWWKH0(,WKH&7(0)$&PRGHOZDVXVHG WRGHYHORSYHKLFOHHPLVVLRQIDFWRUVIRUWKH\HDUFRQVWUXFWLRQVWDUW\HDU(PLVVLRQV DVVRFLDWHGZLWKYHKLFOHWUDYHOGHSHQGRQWKH\HDURIDQDO\VLVEHFDXVHHPLVVLRQFRQWURO WHFKQRORJ\UHTXLUHPHQWVDUHSKDVHGLQRYHUWLPH7KHUHIRUHWKHHDUOLHUWKH\HDUDQDO\]HGLQWKH PRGHOWKHKLJKHUWKHHPLVVLRQUDWHVXWLOL]HGE\&7(0)$&<HDUHPLVVLRQVZHUH FRQVHUYDWLYHO\DVVXPHGDVEHLQJUHSUHVHQWDWLYHRIIXWXUHFRQGLWLRQVRYHUWKHWLPHSHULRGWKDW FDQFHUULVNVDUHHYDOXDWHGVLQFHDVGLVFXVVHGDERYHRYHUDOOYHKLFOHHPLVVLRQVDQGLQSDUWLFXODU GLHVHOWUXFNHPLVVLRQVZLOOGHFUHDVHLQWKHIXWXUH 7KH$'7YROXPHVDQGWUXFNSHUFHQWDJHVZHUHEDVHGRQ&DOWUDQVGDWDIRU+LJKZD\7UDIILF YROXPHVZHUHDVVXPHGWRLQFUHDVHSHUFHQWSHU\HDUIRUDWRWDORIYHKLFOHV+RXUO\ WUDIILFGLVWULEXWLRQVVSHFLILFWRWKHVHVHJPHQWVRI+LJKZD\ZHUHREWDLQHGIURP&DOWUDQV 3HUIRUPDQFH0HDVXUHPHQW6\VWHP3H063H06GDWDLVFROOHFWHGLQUHDOWLPHIURPQHDUO\ LQGLYLGXDOGHWHFWRUVVSDQQLQJWKHIUHHZD\V\VWHPDFURVVDOOPDMRUPHWURSROLWDQDUHDVRI &DOLIRUQLD7KHIUDFWLRQRIWUDIILFYROXPHHDFKKRXUZDVFDOFXODWHGDQGDSSOLHGWRWKH DYHUDJHGDLO\WUDIILFYROXPHVHVWLPDWHWRHVWLPDWHKRXUO\WUDIILFHPLVVLRQUDWHVIRU+LJKZD\ 7KH&7(0)$&YHUVLRQZDVXVHGLQWKHDQDO\VLVEHFDXVH&DOWUDQVKDVQRW\HWUHOHDVHD&7(0)$&YHUVLRQ ZLWKWKHXSGDWHG(0)$&HPLVVLRQVWKDWZRXOGSURYLGH7$&HPLVVLRQUDWHV %D\$UHD$LU4XDOLW\0DQDJHPHQW'LVWULFWRecommended Methods for Screening and Modeling Local Risks and Hazards, Version 3.0. 0D\:HEKWWSVZZZEDDTPGJRYaPHGLDILOHVSODQQLQJDQG UHVHDUFKFHTDULVNPRGHOLQJDSSURDFKPD\SGI"OD HQ KWWSVGRWFDJRYSURJUDPVWUDIILFRSHUDWLRQVPSUSHPVVRXUFH %DVHGRQWUDIILFGDWDIURPWKH&DOWUDQV3H06WUDIILFVSHHGVGXULQJWKHGD\WLPHDQGQLJKWWLPH SHULRGVZHUHLGHQWLILHG)RUQRUWKERXQGWUDIILFWKHIROORZLQJZDVDVVXPHGIRUDOOYHKLFOHV PSK±$OOKRXUVRIWKHGD\H[FHSWDPXQWLOSP PSK±)URPDPXQWLOSP )RUVRXWKERXQGWUDIILFWKHIROORZLQJZDVDVVXPHGIRUDOOYHKLFOHV PSK±$OOKRXUVRIWKHGD\H[FHSWDPXQWLOSP PSK±)URPDPXQWLOSP 7KH$'7IRUHDFKORFDOURDGZD\ZDVFDOFXODWHGEDVHGRQWUDIILFGDWDSURYLGHGE\WKHSURMHFW¶V WUDIILFFRQVXOWDQW$VVXPLQJDSHUFHQWSHU\HDULQFUHDVHWKHSUHGLFWHG$'7RQ$LUSRUW %RXOHYDUGDQG'XEXTXH$YHQXHZDVDQGYHKLFOHVUHVSHFWLYHO\$YHUDJHKRXUO\ WUDIILFGLVWULEXWLRQVIRU6DQ0DWHR&RXQW\URDGZD\VZHUHGHYHORSHGXVLQJWKH(0)$&PRGHO ZKLFKZHUHWKHQDSSOLHGWRWKH$'7YROXPHVWRREWDLQHVWLPDWHGKRXUO\WUDIILFYROXPHVDQG HPLVVLRQVIRUHDFKURDGZD\$QDYHUDJHWUDYHOVSHHGRIPSKIRUWUDIILFRQ$LUSRUW%RXOHYDUG DQGPSKRQ'XEXTXH$YHQXHZDVXVHGIRUDOOKRXUVRIWKHGD\EDVHGRQSRVWHGVSHHGOLPLW VLJQVRQHDFKURDGZD\ 7KLVDQDO\VLVLQYROYHGWKHGHYHORSPHQWRI'30RUJDQLF7$&VDQG30HPLVVLRQVIRUIXWXUH WUDIILFRQ+LJKZD\DQGHDFKORFDOURDGZD\DQGXVLQJWKHVHHPLVVLRQVZLWKDQDLUTXDOLW\ GLVSHUVLRQPRGHOWRFDOFXODWH7$&DQG30FRQFHQWUDWLRQVDWWKHSURMHFW0(,UHFHSWRU ORFDWLRQV0D[LPXPLQFUHDVHGOLIHWLPHFDQFHUULVNVDQGDQQXDO30FRQFHQWUDWLRQVIRUWKH UHFHSWRUVZHUHWKHQFRPSXWHGXVLQJPRGHOHG7$&DQG30FRQFHQWUDWLRQVDQG%$$40' PHWKRGVDQGH[SRVXUHSDUDPHWHUVGHVFULEHGLQAttachment 1 5DLO/LQH&RPPXQLW\5LVN,PSDFWV 7KHSURMHFWVLWHLVORFDWHGQHDUWKH&DOWUDLQUDLOOLQHVDERXWIHHWHDVWRIWKHVLWH5DLODFWLYLW\ RQWKHVHOLQHVFXUUHQWO\JHQHUDWHV7$&DQG30HPLVVLRQVIURPORFRPRWLYHH[KDXVW7KHVHUDLO OLQHVDUHXVHGSULPDULO\IRU&DOWUDLQSDVVHQJHUVHUYLFHKRZHYHUWKHUHLVVRPHIUHLJKWVHUYLFHE\ WUDLQVXVLQJGLHVHOIXHOHGORFRPRWLYHV%DVHGRQWKHFXUUHQW&DOWUDLQVFKHGXOHHIIHFWLYH6HSWHPEHU WKHUHDUHWUDLQVWKDWSDVVWKHSURMHFWVLWHGXULQJZHHNGD\VDQGRQZHHNHQGV,Q DGGLWLRQWRWKHSDVVHQJHUWUDLQVWKHUHDUHDERXWIRXUIUHLJKWWUDLQVWKDWXVHWKHUDLOOLQHVRQDGDLO\ EDVLV &XUUHQWO\DOORI&DOWUDLQ¶VWUDLQVXVHGLHVHOORFRPRWLYHV7KH3HQLQVXOD&RUULGRU(OHFWULILFDWLRQ 3URMHFWLVDNH\FRPSRQHQWRIWKH&DOWUDLQ0RGHUQL]DWLRQ3URJUDPWKDWZRXOGHOHFWULI\WKH&DOWUDLQ &RUULGRUIURP6DQ)UDQFLVFRWRWKH7DPLHQ&DOWUDLQVWDWLRQLQ6DQ-RVp$VSDUWRIWKHSURJUDPWR +H[DJRQ7UDQVSRUWDWLRQ&RQVXOWDQWV)LOHFigure 1 Existing Traffic Volumes.pdf 7KH%XUGHQRXWSXWIURP(0)$&DSUHYLRXVYHUVLRQRI&$5%¶V(0)$&PRGHOZDVXVHGIRUWKLVVLQFHWKH FXUUHQWZHEEDVHGYHUVLRQRI(0)$&GRHVQRWLQFOXGH%XUGHQW\SHRXWSXWZLWKKRXUE\KRXUWUDIILFYROXPH LQIRUPDWLRQ 86'HSDUWPHQWRI7UDQVSRUWDWLRQ)HGHUDO5DLOURDG$GPLQLVWUDWLRQ86'27&URVVLQJ,QYHQWRU\)RUPIRU &URVVLQJ*5HYLVLRQ'DWH PRGHUQL]HRSHUDWLRQRIWKH&DOWUDLQUDLOFRUULGRUEHWZHHQ6DQ-RVpDQG6DQ)UDQFLVFR&DOWUDLQLV SODQQLQJWRSKDVHLQWKHFKDQJHIURPXVLQJGLHVHOORFRPRWLYHVWRXVHRIHOHFWULFWUDLQV7KLVSODQ ZDVIRUPDOO\DGRSWHGRQ-DQXDU\DQGHOHFWULILHGVHUYLFHLVDQWLFLSDWHGWREHJLQLQODWH &DOWUDLQSODQVDUHWKDWLQLWLDOVHUYLFHEHWZHHQ6DQ-RVpDQG6DQ)UDQFLVFRZRXOGXVHDPL[HGIOHHW RIHOHFWULFDQGGLHVHOORFRPRWLYHVZLWKDSSUR[LPDWHO\SHUFHQWRIWKHVHUYLFHEHLQJHOHFWULFDQG SHUFHQWEHLQJGLHVHO$IWHUWKHLQLWLDOLPSOHPHQWDWLRQSHULRGGLHVHOORFRPRWLYHVZRXOGEH UHSODFHGZLWKHOHFWULFWUDLQVRYHUWLPHDVWKH\UHDFKWKHHQGRIWKHLUVHUYLFHOLIH&DOWUDLQ¶VGLHVHO SRZHUHGORFRPRWLYHVZRXOGFRQWLQXHWREHXVHGWRSURYLGHVHUYLFHEHWZHHQWKH6DQ-RVp'LULGRQ 6WDWLRQDQG*LOUR\,WLVH[SHFWHGWKDWDOORIWKH6DQ-RVpWR6DQ)UDQFLVFRIOHHWZRXOGEHHOHFWULF WUDLQVDERXWILYHWRHLJKW\HDUVDIWHULQLWLDOHOHFWULFVHUYLFHEHJLQV 6WDUWLQJLQODWHZLWK&DOWUDLQHOHFWULILFDWLRQWKHUHZRXOGEHGDLO\ZHHNGD\WULSVDQG GDLO\ZHHNHQGWULSVXVLQJWUDLQVZLWKGLHVHOORFRPRWLYHV2QDQDQQXDODYHUDJHEDVLVWKLVZRXOG EHDQDYHUDJHRIGDLO\WUDLQVXVLQJGLHVHOORFRPRWLYHV8VHRIWKHVHGLHVHOWUDLQVE\&DOWUDLQ EHWZHHQ6DQ)UDQFLVFRDQG6DQ-RVHZRXOGEHSKDVHGRXWRYHUWLPHDQGUHSODFHGE\HOHFWULFWUDLQV $OOWUDLQVXVHGIRUIUHLJKWVHUYLFHZHUHDVVXPHGWRXVHGLHVHOSRZHUHGORFRPRWLYHV Rail Line Emissions )RUWKLVHYDOXDWLRQWKHUDLOH[SRVXUHSHULRGZDVDVVXPHGWREHJLQLQFRLQFLGHQWZLWKWKH EHJLQQLQJRISURMHFWFRQVWUXFWLRQ,QFDOFXODWLQJFDQFHUULVNVIURP'30HPLVVLRQVIURPUDLOOLQH GLHVHOORFRPRWLYHVD\HDUH[SRVXUHSHULRGZDVXVHGDVWKLVLVWKHPD[LPXPOHQJWKRIWLPHD FKLOGZRXOGEHDWWKHORFDWLRQRIWKHFRQVWUXFWLRQ0(,<0&$*DWHZD\&KLOG'HYHORSPHQW &HQWHU,QWKLVFDVHWKHH[SRVXUHSHULRGDWWKHFRQVWUXFWLRQ0(,ZRXOGEHIURPWKURXJK )RUFDOFXODWLQJHPLVVLRQVIURP&DOWUDLQORFRPRWLYHVLWZDVDVVXPHGWKDWGXULQJWKHDQG FRQVWUXFWLRQSHULRGDOOWUDLQVZRXOGFRQWLQXHWRXVHGLHVHOORFRPRWLYHV$ORQJWKHUDLOOLQHQHDU WKHSURMHFWVLWHWKHUHZRXOGEHDQDYHUDJHRIGDLO\WUDLQVXVLQJGLHVHOORFRPRWLYHVRQDQDQQXDO DYHUDJHEDVLV6WDUWLQJLQZKHQ&DOWUDLQHOHFWULILFDWLRQRFFXUVWKHUHZRXOGEHGDLO\ ZHHNGD\WULSVDQGGDLO\ZHHNHQGWULSVXVLQJWUDLQVZLWKGLHVHOORFRPRWLYHV2QDQDQQXDO DYHUDJHEDVLVWKHUHZRXOGEHDWRWDORIGDLO\WUDLQVXVLQJGLHVHOORFRPRWLYHV$OWKRXJKWKHVH GLHVHOORFRPRWLYHVZRXOGEHUHSODFHGRYHUWLPHZLWKHOHFWULFORFRPRWLYHVLWZDVFRQVHUYDWLYHO\ DVVXPHGIRUWKLVHYDOXDWLRQWKDWGLHVHOHPLVVLRQVZRXOGUHPDLQDWWKHOHYHOVLQWKHIXWXUH$OO WUDLQVXVHGIRUIUHLJKWVHUYLFHZHUHDVVXPHGWRXVHGLHVHOSRZHUHGORFRPRWLYHV,QWKHYLFLQLW\RI WKHSURMHFWVLWHDOOWUDLQVZHUHDVVXPHGWREHWUDYHOLQJDWDQDYHUDJHVSHHGPSK &DOWUDLQPeninsula Corridor Electrification Project. Final Environmental Impact Report. 'HFHPEHU &DOWUDLQPeninsula Corridor Electrification Fact Sheet. 0D\ &DOWUDLQCaltrain Electrification Delayed to 2024-XQH6HH www.caltrain.com/about/MediaRelations/news/Caltrain_Electrification_Delayed_to_2024.html &DOWUDLQShort Range Transit Plan:FY2015-20242FWREHU &DOWUDLQShort Range Transit Plan:FY2015-20242FWREHU &DOWUDLQShort Range Transit Plan:FY2015-20242FWREHU '30DQG30HPLVVLRQVIURPWUDLQVRQWKHUDLOOLQHZHUHFDOFXODWHGXVLQJ(3$HPLVVLRQIDFWRUV IRUORFRPRWLYHVDQG&$5%DGMXVWPHQWIDFWRUVWRDFFRXQWIRUIXHOVXVHGLQ&DOLIRUQLD&DOWUDLQ¶V FXUUHQWORFRPRWLYHIOHHWFRQVLVWVRIWZHQW\WKUHHKRUVHSRZHUKSORFRPRWLYHVRIPRGHO\HDU RURYHUKDXOGDWHRIRUODWHUWKUHHKSORFRPRWLYHVRIPRGHO\HDUDQGVL[ KSORFRPRWLYHVRIPRGHO\HDU7KHFXUUHQWIOHHWDYHUDJHORFRPRWLYHHQJLQHVL]HLVDERXW KS,QHVWLPDWLQJGLHVHOHPLVVLRQVIRUDQGSULRUWRHOHFWULILFDWLRQDIOHHWDYHUDJH ORFRPRWLYHHQJLQHVL]HRIKSZDVXVHG:KHQHOHFWULILFDWLRQRFFXUV&DOWUDLQZLOOLQLWLDOO\ UHWDLQWKHVL[KSORFRPRWLYHVDQGWKHWKUHHPRGHO\HDUKSORFRPRWLYHV,Q HVWLPDWLQJGLHVHOORFRPRWLYHHPLVVLRQVIRUWKHFDVHRIHOHFWULILFDWLRQDQDYHUDJHORFRPRWLYH KRUVHSRZHURIKSZDVXVHG(PLVVLRQVIURPWKHIUHLJKWWUDLQVZHUHFDOFXODWHGDVVXPLQJ WKH\ZRXOGXVHWZRGLHVHOORFRPRWLYHVZLWKKSHQJLQHVWRWDORIKSDQGZRXOGEH WUDYHOLQJDWPSK6LQFHWKHH[SRVXUHGXUDWLRQXVHGLQFDOFXODWLQJFKLOGFDQFHUULVNVDWWKH0(, ORFDWLRQLV\HDUVWKHSDVVHQJHUDQGIUHLJKWWUDLQDYHUDJH'30DQG30HPLVVLRQVZHUH FDOFXODWHGEDVHGRQDYHUDJH(3$HPLVVLRQIDFWRUVIRUWKHSHULRGVDQG Dispersion Modeling 'LVSHUVLRQPRGHOLQJRI7$&DQG30HPLVVLRQVZDVFRQGXFWHGXVLQJWKH86(3$$(502' GLVSHUVLRQPRGHOZKLFKLVUHFRPPHQGHGE\WKH%$$40'IRUWKLVW\SHRIDQDO\VLV7$&DQG 30HPLVVLRQVIURPWUDIILFRQWKHURDGZD\VZLWKLQDERXWIHHWRIWKHSURMHFWVLWHZHUH HYDOXDWHGZLWKWKHPRGHO(PLVVLRQVIURPYHKLFOHWUDIILFDQGORFRPRWLYHVZHUHPRGHOHGLQ $(502'XVLQJDVHULHVRIYROXPHVRXUFHVDORQJDOLQHOLQHYROXPHVRXUFHVZLWKOLQH VHJPHQWVXVHGWRUHSUHVHQWWKHWUDYHOODQHVRQWKHURDGZD\VDQGUDLOZD\V7KHVDPH PHWHRURORJLFDOGDWDDQGRIIVLWHVHQVLWLYHUHFHSWRUVXVHGLQWKHSUHYLRXVFRQVWUXFWLRQGLVSHUVLRQ PRGHOLQJZHUHXVHGLQWKHKLJKZD\URDGZD\DQGUDLOZD\PRGHOLQJ2WKHULQSXWVWRWKHPRGHO LQFOXGHGURDGJHRPHWU\KRXUO\WUDIILFHPLVVLRQVDQGUHFHSWRUORFDWLRQVDQGKHLJKWV$QQXDO 7$&DQG30FRQFHQWUDWLRQVIRUIURPWUDIILFRQWKHURDGZD\VZHUHFDOFXODWHGXVLQJWKH PRGHO&RQFHQWUDWLRQVZHUHFDOFXODWHGDWWKHSURMHFW0(,VZLWKUHFHSWRUKHLJKWVRIIHHW PHWHUWRUHSUHVHQWWKHEUHDWKLQJKHLJKWVRIFKLOGUHQRQWKHILUVWIORRURIWKHQHDUE\VFKRRO )LJXUHVKRZVWKHURDGZD\DQGUDLOZD\VHJPHQWVPRGHOHGDQGUHVLGHQWLDO0(,UHFHSWRU ORFDWLRQXVHGLQWKHPRGHOLQJ7DEOHOLVWVWKHULVNVDQGKD]DUGVIURPWKHURDGZD\7KH HPLVVLRQUDWHVDQGURDGZD\FDOFXODWLRQVXVHGLQWKHDQDO\VLVDUHVKRZQLQAttachment 5 %$$40'3HUPLWWHG6WDWLRQDU\6RXUFHV 3HUPLWWHGVWDWLRQDU\VRXUFHVRIDLUSROOXWLRQQHDUWKHSURMHFWVLWHZHUHLGHQWLILHGXVLQJ%$$40'¶V Permitted Stationary Sources 2020*,6ZHEVLWH ZKLFK LGHQWLILHV WKH ORFDWLRQ RI QHDUE\ VWDWLRQDU\ VRXUFHV DQG WKHLU HVWLPDWHG ULVN DQG KD]DUG LPSDFWV LQFOXGLQJ HPLVVLRQV DQG DGMXVWPHQWVWRDFFRXQWIRUQHZ2(++$JXLGDQFH(OHYHQVRXUFHVZHUHLGHQWLILHGXVLQJWKLVWRRO Emission Factors for Locomotives86(3$(3$) Offroad Modeling, Change Technical Memo&KDQJHVWRWKH/RFRPRWLYH,QYHQWRU\&$5%-XO\ &DOWUDLQCommute Fleets$YDLODEOHDWKWWSZZZFDOWUDLQFRPDERXWVWDWVDQGUHSRUWVKWPO$FFHVVHG-DQXDU\ &DOWUDLQShort Range Transit Plan:FY2015-20242FWREHU %$$40'Recommended Methods for Screening and Modeling Local Risks and Hazards0D\ %$$40' KWWSVEDDTPGPDSVDUFJLVFRPDSSVZHEDSSYLHZHULQGH[KWPO"LG DHIEGDD VHYHQDUHJHQHUDWRUVRQHLVDJDVROLQHGLVSHQVLQJIDFLOLW\DQGWZRKDYHQRGDWDDQGZHUHWUHDWHG DVD³JHQHULFFDVH´IRUZRUVWFDVHULVNVFUHHQLQJSXUSRVHV2QHVRXUFHZDVLGHQWLILHGDVSDUWRIWKH H[LVWLQJVLWHDQGZRXOGEHGHPROLVKHGGXULQJFRQVWUXFWLRQ$6WDWLRQDU\6RXUFH,QIRUPDWLRQ)RUP 66,)FRQWDLQLQJWKHLGHQWLILHGVRXUFHVZDVSUHSDUHGDQGVXEPLWWHGWR%$$40'%$$40' SURYLGHGLQSXWDQGFODULILFDWLRQDERXWWKHVWDWLRQDU\VRXUFHV7KHVFUHHQLQJOHYHOULVNVDQGKD]DUGV SURYLGHGE\%$$40'IRUWKHVWDWLRQDU\VRXUFHVZHUHDGMXVWHGIRUGLVWDQFHXVLQJ%$$40'¶V Distance Adjustment Multiplier Tool for Diesel Internal Combustion Engines, Gasoline Dispensing Facility, and Generic Equipment&RPPXQLW\ULVNLPSDFWVIURPWKHVWDWLRQDU\VRXUFH XSRQWKH0(,DUHUHSRUWHGLQ7DEOH 1HDUE\&RQVWUXFWLRQ3URMHFWV 7KH &LW\ KDV HQWLWOHG WZR QHDUE\ GHYHORSPHQW SURMHFWV WKDW FRXOG FRQFHLYDEO\ EH DFWLYH FRQVHFXWLYHO\ZLWKWKHSURSRVHG3URMHFW7KHVHLQFOXGHWKH$LUSRUW%RXOHYDUGSURMHFWWKDW ZRXOGFRQVWUXFWDVWRU\KRWHOZLWKURRPVDERXWIHHWQRUWKRIWKHSURSRVHG3URMHFW7KH RWKHUSURMHFWLVORFDWHGDW*DWHZD\%RXOHYDUGDERXWIHHWVRXWKHDVWRIWKHSURSRVHG3URMHFW WKDWZRXOGUHQRYDWHWKHH[WHULRURIWKHH[LVWLQJEXLOGLQJ1HLWKHUSURMHFWLVGRZQZLQGRIWKHSURMHFW VLWHWKHUHIRUHGLVSHUVLRQFRQGLWLRQVWKDWZRXOGWUDQVSRUWSROOXWDQWVRIFRQWDPLQDQWVWRWKH3URMHFW VLWHRUWKHSURMHFW0(,JHQHUDOO\ZRXOGQRWRFFXU)XUWKHUPRUHERWK3URMHFWVDUHFRQGLWLRQHG WKURXJK PLWLJDWLRQ WR FRQWURO HPLVVLRQV IURP FRQVWUXFWLRQ DFWLYLWLHV WR UHGXFH QHDUE\ FRQVWUXFWLRQKHDOWKULVNLPSDFWV7KHUHDUHRWKHUHQWLWOHGGHYHORSPHQWVLQWKHDUHDEXWWKH\DUH RXWVLGHRIWKLVSURMHFW¶VIRRWLQIOXHQFHDUHD &RQFOXVLRQ$,5 7DEOHUHSRUWVERWKWKHSURMHFWDQGFXPXODWLYHFRPPXQLW\ULVNLPSDFWVDWWKHVHQVLWLYHUHFHSWRUV PRVWDIIHFWHGE\FRQVWUXFWLRQLHWKH0(,7KHSURMHFWZRXOGKDYHDQH[FHHGDQFHZLWKUHVSHFW WRFRPPXQLW\ULVNFDXVHGE\SURMHFWFRQVWUXFWLRQDFWLYLWLHVVLQFHWKHFDQFHUULVNH[FHHGVWKH %$$40'VLQJOHVRXUFHWKUHVKROGV+RZHYHUZLWKWKHLPSOHPHQWDWLRQRI00$,5DDQG00 $,5EWKHFDQFHUULVNZRXOGEHUHGXFHGEHORZWKH%$$40'VLQJOHVRXUFHWKUHVKROG$QQXDO 30FRQFHQWUDWLRQDQGKD]DUGLQGH[GRQRWH[FHHGWKH%$$40'VLQJOHVRXUFHDQGFXPXODWLYH VRXUFHWKUHVKROGV 6RXWK6DQ)UDQFLVFR'HYHORSPHQWDQG&RQVWUXFWLRQ0DS6HHKWWSVFRQVWUXFWLRQVVIQHWDFFHVVHG 1RYHPEHU 7DEOH ,PSDFWVIURP&RPELQHG6RXUFHVDW3URMHFW0(, 6RXUFH&DQFHU5LVN SHUPLOOLRQ $QQXDO30 JP +D]DUG ,QGH[ 3URMHFW,PSDFWV 7RWDO0D[LPXP3URMHFW,PSDFWV<HDUV±8QPLWLJDWHG 0LWLJDWHG BAAQMD Single-Source Threshold 6.0 0.3 1.0 Exceed Threshold? 8QPLWLJDWHG 0LWLJDWHG Yes No No No No No &XPXODWLYH,PSDFWV +LJKZD\ &DO7UDLQ=RQH $LUSRUW%RXOHYDUG 'XEXTXH$YHQXH *HQHQWHFK,QF)DFLOLW\,'*HQHUDWRU0(,DW IHHW %RVWRQ3URSHUWLHV)DFLOLW\,'*HQHUDWRU0(,DW IHHW %LRWHFK*DWHZD\±+&3FR&%5()DFLOLW\,' *HQHUDWRU0(,DWIHHW 0DFUR*HQLFV:HVW,QF)DFLOLW\,'*HQHUDWRU0(,DW IHHW $OH[DQGULD5HDO(VWDWH(TXLWLHV,QF)DFLOLW\,' *HQHUDWRU0(,DWIHHW /RZHV+,:,QF)DFLOLW\,'*HQHUDWRU0(,DW IHHW +HDOWK3ODQRI6DQ0DWHR)DFLOLW\,'*HQHUDWRU0(, DWIHHW *DWHZD\&HQWHU/3)DFLOLW\,'1R'DWD0(,DW IHHW *DWHZD\%RXOHYDUG)DFLOLW\,'1R'DWD 0(,DWIHHW $LUSRUW%RXOHYDUG6KHOO)DFLOLW\,'B*DV 'LVSHQVLQJ)DFLOLW\0(,DWIHHW &XPXODWLYH7RWDO8QPLWLJDWHG 0LWLJDWHG BAAQMD Cumulative Source Threshold 100 0.8 10.0 ([FHHG7KUHVKROG"8QPLWLJDWHG 0LWLJDWHG No No No No No No Mitigation Measure AQ-1 - ,PSOHPHQW*HQHUDO3ODQ00$,5DVHHDERYH Mitigation Measure AQ-2 - ,PSOHPHQW*HQHUDO3ODQ00$,5E 00$,5E 7KH3URMHFWLVORFDWHGZLWKLQIHHWRIVHQVLWLYHUHFHSWRUVWKHUHIRUHDKHDOWKULVNDVVHVVPHQW RISURMHFWHPLVVLRQVZDVFRQGXFWHG&DQFHUULVNWKUHVKROGVZRXOGEHH[FHHGHGDWWKH*DWHZD\ &KLOG 'HYHORSPHQW &HQWHU <0&$ LH VFKRRO FKLOGUHQ $GGLWLRQDO PHDVXUHV WR UHGXFH FRQVWUXFWLRQSHULRG7$&HPLVVLRQVDUHUHTXLUHGXQGHU00$,5E7KH3URMHFWZRXOGEH UHTXLUHGWRLPSOHPHQWDIHDVLEOHSODQWRUHGXFH'30HPLVVLRQVE\DWOHDVWSHUFHQWVXFKWKDW LQFUHDVHGFDQFHUULVNDQGDQQXDO30FRQFHQWUDWLRQVIURPFRQVWUXFWLRQZRXOGEHUHGXFHGEHORZ 7$&VLJQLILFDQFHOHYHOVDVIROORZV $OOFRQVWUXFWLRQHTXLSPHQWODUJHUWKDQKRUVHSRZHUXVHGDWWKHVLWHIRUPRUHWKDQWZR FRQWLQXRXVGD\VRUKRXUVWRWDOVKDOOPHHW86(3$7LHUHPLVVLRQVWDQGDUGVIRU30 30DQG30LIIHDVLEOHRWKHUZLVH D,IXVHRI7LHUHTXLSPHQWLVQRWDYDLODEOHDOWHUQDWLYHO\XVHHTXLSPHQWWKDWPHHWV 86(3$HPLVVLRQVWDQGDUGVIRU7LHUHQJLQHVDQGLQFOXGHSDUWLFXODWHPDWWHU HPLVVLRQVFRQWUROHTXLYDOHQWWR&$5%/HYHOYHULILDEOHGLHVHOHPLVVLRQFRQWURO GHYLFHVWKDWDOWRJHWKHUDFKLHYHDWOHDVWDSHUFHQWUHGXFWLRQLQSDUWLFXODWHPDWWHU H[KDXVW LQ FRPSDULVRQ WR XQFRQWUROOHG HTXLSPHQW DOWHUQDWLYHO\RU LQ FRPELQDWLRQ E8VHRIHOHFWULFDORUQRQGLHVHOIXHOHGHTXLSPHQW 'HZDWHULQJSXPSVVKDOOEHSRZHUHGE\HOHFWULFLW\ 8VHRIHOHFWULFSRUWDEOHHTXLSPHQWIROORZLQJWKHVLWHSUHSDUDWLRQDQGJUDGLQJSKDVHV $OWHUQDWLYHO\ WKH DSSOLFDQW PD\ GHYHORS DQRWKHU FRQVWUXFWLRQ RSHUDWLRQV SODQ GHPRQVWUDWLQJWKDWWKHFRQVWUXFWLRQHTXLSPHQWXVHGRQVLWHZRXOGDFKLHYHDUHGXFWLRQLQ FRQVWUXFWLRQGLHVHOSDUWLFXODWHPDWWHUHPLVVLRQVE\SHUFHQWRUJUHDWHU(OHPHQWVRIWKH SODQFRXOGLQFOXGHDFRPELQDWLRQRIVRPHRIWKHIROORZLQJPHDVXUHV ͻ,PSOHPHQWDWLRQRI1RDERYHWRXVH7LHURUDOWHUQDWLYHO\IXHOHGHTXLSPHQW ͻ,QVWDOODWLRQRIHOHFWULFSRZHUOLQHVGXULQJHDUO\FRQVWUXFWLRQSKDVHVWRDYRLGXVHRI GLHVHOJHQHUDWRUVDQGFRPSUHVVRUV ͻ8VHRIHOHFWULFDOO\SRZHUHGHTXLSPHQW ͻ)RUNOLIWVDQGDHULDOOLIWVXVHGIRUH[WHULRUDQGLQWHULRUEXLOGLQJFRQVWUXFWLRQVKDOOEH HOHFWULFRUSURSDQHQDWXUDOJDVSRZHUHG ͻ&KDQJHLQFRQVWUXFWLRQEXLOGRXWSODQVWROHQJWKHQSKDVHVDQG ͻ,PSOHPHQWDWLRQRIGLIIHUHQWEXLOGLQJWHFKQLTXHVWKDWUHVXOWLQOHVVGLHVHOHTXLSPHQW XVDJH 6XFKDFRQVWUXFWLRQRSHUDWLRQVSODQZRXOGEHVXEMHFWWRUHYLHZE\DQDLUTXDOLW\H[SHUWDQG DSSURYHGE\WKH&LW\SULRUWRFRQVWUXFWLRQ Effectiveness of Mitigation Measure AQ-1 and AQ-2 (MM AIR-1a and MM AIR-1b) &DO((0RGZDVXVHGWRFRPSXWHHPLVVLRQVDVVRFLDWHGZLWKWKLVPLWLJDWLRQPHDVXUHDVVXPLQJWKDW DOO HTXLSPHQW PHW 86 (3$ 7LHU ,QWHULP HQJLQH VWDQGDUGV :LWK WKHVH LPSOHPHQWHG WKH SURMHFW¶VFRQVWUXFWLRQFDQFHUULVNOHYHOVDVVXPLQJLQIDQWH[SRVXUHZRXOGEHUHGXFHGE\ SHUFHQWWRFKDQFHVSHUPLOOLRQ$VVXPLQJDOHVVHUOHYHORIPLWLJDWLRQWKDWDFKLHYHVD SHUFHQWUHGXFWLRQLQWKHSURMHFW¶VFDQFHUULVNLQFUHDVHGFDQFHUULVNVZRXOGEHUHGXFHGWREHORZ FKDQFHVSHUPLOOLRQ$VDUHVXOWWKHSURMHFW¶VFRQVWUXFWLRQULVNVZRXOGEHUHGXFHGEHORZWKH %$$40'VLQJOHVRXUFHWKUHVKROGV *5((1+286(*$6(0,66,216 6HWWLQJ *DVHVWKDWWUDSKHDWLQWKHDWPRVSKHUH*+*VUHJXODWHWKHHDUWK¶VWHPSHUDWXUH7KLVSKHQRPHQRQ NQRZQDVWKHJUHHQKRXVHHIIHFWLVUHVSRQVLEOHIRUPDLQWDLQLQJDKDELWDEOHFOLPDWH7KHPRVW FRPPRQ*+*VDUHFDUERQGLR[LGH&2DQGZDWHUYDSRUEXWWKHUHDUHDOVRVHYHUDORWKHUVPRVW LPSRUWDQWO\PHWKDQH&+QLWURXVR[LGH12K\GURIOXRURFDUERQV+)&VSHUIOXRURFDUERQV 3)&VDQGVXOIXUKH[DIOXRULGH6)7KHVHDUHUHOHDVHGLQWRWKHHDUWK¶VDWPRVSKHUHWKURXJKD YDULHW\RIQDWXUDOSURFHVVHVDQGKXPDQDFWLYLWLHV6RXUFHVRI*+*VDUHJHQHUDOO\DVIROORZV x&2&+DQG12DUHE\SURGXFWVRIIRVVLOIXHOFRPEXVWLRQ x12LVDVVRFLDWHGZLWKDJULFXOWXUDORSHUDWLRQVVXFKDVIHUWLOL]DWLRQRIFURSV x&+ LV FRPPRQO\ FUHDWHG E\ RIIJDVVLQJ IURP DJULFXOWXUDO SUDFWLFHV HJ NHHSLQJ OLYHVWRFNDQGODQGILOORSHUDWLRQV x&KORURIOXRURFDUERQV&)&VZHUHZLGHO\XVHGDVUHIULJHUDQWVSURSHOODQWVDQGFOHDQLQJ VROYHQWVEXWWKHLUSURGXFWLRQKDVEHHQVWRSSHGE\LQWHUQDWLRQDOWUHDW\ x+)&VDUHQRZXVHGDVDVXEVWLWXWHIRU&)&VLQUHIULJHUDWLRQDQGFRROLQJ x3)&V DQG VXOIXU KH[DIOXRULGH HPLVVLRQV DUH FRPPRQO\ FUHDWHG E\LQGXVWULHV VXFK DV DOXPLQXPSURGXFWLRQDQGVHPLFRQGXFWRUPDQXIDFWXULQJ (DFK*+*KDVLWVRZQSRWHQF\DQGHIIHFWXSRQWKHHDUWK¶VHQHUJ\EDODQFH7KLVLVH[SUHVVHGLQ WHUPVRIDJOREDOZDUPLQJSRWHQWLDO*:3ZLWK&2EHLQJDVVLJQHGDYDOXHRIDQGVXOIXU KH[DIOXRULGHEHLQJVHYHUDORUGHUVRIPDJQLWXGHVWURQJHU,Q*+*HPLVVLRQLQYHQWRULHVWKHZHLJKW RIHDFKJDVLVPXOWLSOLHGE\LWV*:3DQGLVPHDVXUHGLQXQLWVRI&2HTXLYDOHQWV&2H $Q H[SDQGLQJ ERG\ RI VFLHQWLILF UHVHDUFK VXSSRUWV WKH WKHRU\ WKDW JOREDO FOLPDWH FKDQJH LV FXUUHQWO\DIIHFWLQJFKDQJHVLQZHDWKHUSDWWHUQVDYHUDJHVHDOHYHORFHDQDFLGLILFDWLRQFKHPLFDO UHDFWLRQUDWHVDQGSUHFLSLWDWLRQUDWHVDQGWKDWLWZLOOLQFUHDVLQJO\GRVRLQWKHIXWXUH7KHFOLPDWH DQGVHYHUDOQDWXUDOO\RFFXUULQJUHVRXUFHVZLWKLQ&DOLIRUQLDDUHDGYHUVHO\DIIHFWHGE\WKHJOREDO ZDUPLQJWUHQG,QFUHDVHGSUHFLSLWDWLRQDQGVHDOHYHOULVHZLOOLQFUHDVHFRDVWDOIORRGLQJVDOWZDWHU LQWUXVLRQDQGGHJUDGDWLRQRIZHWODQGV0DVVPLJUDWLRQDQGRUORVVRISODQWDQGDQLPDOVSHFLHV FRXOGDOVRRFFXU3RWHQWLDOHIIHFWVRIJOREDOFOLPDWHFKDQJHWKDWFRXOGDGYHUVHO\DIIHFWKXPDQ KHDOWKLQFOXGHPRUHH[WUHPHKHDWZDYHVDQGKHDWUHODWHGVWUHVVDQLQFUHDVHLQFOLPDWHVHQVLWLYH GLVHDVHVPRUHIUHTXHQWDQGLQWHQVHQDWXUDOGLVDVWHUVVXFKDVIORRGLQJKXUULFDQHVDQGGURXJKWDQG LQFUHDVHGOHYHOVRIDLUSROOXWLRQ )HGHUDODQG6WDWHZLGH*+*(PLVVLRQV 7KH86(3$UHSRUWHGWKDWLQWRWDOJURVVQDWLRQZLGH*+*HPLVVLRQVZHUHPLOOLRQ PHWULFWRQV007FDUERQGLR[LGHHTXLYDOHQW&2H7KHVHHPLVVLRQVZHUHORZHUWKDQSHDN OHYHOVRI007WKDWZHUHHPLWWHGLQ&$5%XSGDWHVWKHVWDWHZLGH*+*HPLVVLRQ 8QLWHG6WDWHV(QYLURQPHQWDO3URWHFWLRQ$JHQF\Draft Inventory of U.S. Greenhouse Gas Emissions and Sinks 1990-2020)HEUXDU\:HEKWWSVZZZHSDJRYJKJHPLVVLRQVLQYHQWRU\XVJUHHQKRXVHJDVHPLVVLRQVDQG VLQNV LQYHQWRU\RQDQDQQXDOEDVLVZKHUHWKHODWHVWLQYHQWRU\LQFOXGHVWKURXJKHPLVVLRQV ,Q*+*HPLVVLRQVIURPVWDWHZLGHHPLWWLQJDFWLYLWLHVZHUH007&2H7KH HPLVVLRQVKDYHGHFUHDVHGE\SHUFHQWVLQFHSHDNOHYHOVLQDQGDUH007&2HORZHU WKDQHPLVVLRQVOHYHODQGDOPRVW007&2HEHORZWKH6WDWH¶V*+*OLPLWRI 007&2H3HUFDSLWD*+*HPLVVLRQVLQ&DOLIRUQLDKDYHGURSSHGIURPDSHDNRI07 &2HSHUSHUVRQWR07&2HSHUSHUVRQLQ 5HFHQW5HJXODWRU\$FWLRQVIRU*+*(PLVVLRQV Executive Order S-3-05 – California GHG Reduction Targets ([HFXWLYH2UGHU(26ZDVVLJQHGE\*RYHUQRU$UQROG6FKZDU]HQHJJHULQWRVHW*+* HPLVVLRQUHGXFWLRQWDUJHWVIRU&DOLIRUQLD7KHWKUHHWDUJHWVHVWDEOLVKHGE\WKLV(2DUHDVIROORZV UHGXFH&DOLIRUQLD¶V*+*HPLVVLRQVWROHYHOVE\UHGXFH&DOLIRUQLD¶V*+* HPLVVLRQVWROHYHOVE\DQGUHGXFH&DOLIRUQLD¶V*+*HPLVVLRQVE\SHUFHQWEHORZ OHYHOVE\ Assembly Bill 32 – California Global Warming Solutions Act (2006) $VVHPEO\%LOO$%WKH*OREDO:DUPLQJ6ROXWLRQV$FWRIFRGLILHGWKH6WDWH¶V*+* HPLVVLRQVWDUJHWE\GLUHFWLQJ&$5%WRUHGXFHWKH6WDWH¶VJOREDOZDUPLQJHPLVVLRQVWROHYHOV E\$%ZDVVLJQHGDQGSDVVHGLQWRODZE\*RYHUQRU6FKZDU]HQHJJHURQ6HSWHPEHU 6LQFHWKDWWLPHWKH&$5%&(&&DOLIRUQLD3XEOLF8WLOLWLHV&RPPLVVLRQ&38&DQG %XLOGLQJ6WDQGDUGV&RPPLVVLRQKDYHDOOEHHQGHYHORSLQJUHJXODWLRQVWKDWZLOOKHOSPHHWWKHJRDOV RI$%DQG([HFXWLYH2UGHU6ZKLFKKDVDWDUJHWRIUHGXFLQJ*+*HPLVVLRQVSHUFHQW EHORZOHYHOV $6FRSLQJ3ODQIRU$%ZDVDGRSWHGE\&$5%LQ'HFHPEHU,WFRQWDLQVWKH6WDWH¶VPDLQ VWUDWHJLHVWRUHGXFH*+*VIURPEXVLQHVVDVXVXDOHPLVVLRQVSURMHFWHGLQEDFNGRZQWR OHYHOV %XVLQHVVDVXVXDO %$8 LV WKH SURMHFWHG HPLVVLRQV LQ LQFOXGLQJ LQFUHDVHV LQ HPLVVLRQVFDXVHGE\JURZWKZLWKRXWDQ\*+*UHGXFWLRQPHDVXUHV7KH6FRSLQJ3ODQKDVDUDQJH RI *+* UHGXFWLRQ DFWLRQV LQFOXGLQJ GLUHFW UHJXODWLRQV DOWHUQDWLYH FRPSOLDQFH PHFKDQLVPV PRQHWDU\DQGQRQPRQHWDU\LQFHQWLYHVYROXQWDU\DFWLRQVDQGPDUNHWEDVHGPHFKDQLVPVVXFKDV DFDSDQGWUDGHV\VWHP $VGLUHFWHGE\$%&$5%KDVDOVRDSSURYHGDVWDWHZLGH*+*HPLVVLRQVOLPLW2Q'HFHPEHU &$5%VWDIIUHVROYHGDQDPRXQWRIPLOOLRQPHWULFWRQV007RI&2HDVWKHWRWDO VWDWHZLGH*+*HPLVVLRQVOHYHODQGHPLVVLRQVOLPLW7KHOLPLWLVDFXPXODWLYHVWDWHZLGH OLPLWQRWDVHFWRURUIDFLOLW\VSHFLILFOLPLW&$5%XSGDWHGWKHIXWXUH%$8DQQXDOHPLVVLRQV IRUHFDVWLQOLJKWRIWKHHFRQRPLFGRZQWXUQWR007RI&2H7ZR*+*HPLVVLRQVUHGXFWLRQ PHDVXUHVFXUUHQWO\HQDFWHGWKDWZHUHQRWSUHYLRXVO\LQFOXGHGLQWKH6FRSLQJ3ODQEDVHOLQH LQYHQWRU\ZHUHLQFOXGHGIXUWKHUUHGXFLQJWKHEDVHOLQHLQYHQWRU\WR007RI&2H7KXVDQ HVWLPDWHGUHGXFWLRQRI007RI&2HLVQHFHVVDU\WRUHGXFHVWDWHZLGHHPLVVLRQVWRPHHWWKH $%WDUJHWE\ &$5%California Greenhouse Gas Emission for 2000 to 2019:HE KWWSVZZDUEFDJRYFFLQYHQWRU\SXEVUHSRUWVBJKJBLQYHQWRU\BWUHQGVBSGI Executive Order B-30-15 & Senate Bill 32 GHG Reduction Targets – 2030 GHG Reduction Target ,Q$SULO*RYHUQRU%URZQVLJQHG(2%ZKLFKH[WHQGHGWKHJRDOVRI$%VHWWLQJ D*+*HPLVVLRQVWDUJHWDWSHUFHQWRIOHYHOVE\2Q6HSWHPEHU*RYHUQRU %URZQVLJQHG6HQDWH%LOO6%ZKLFKOHJLVODWLYHO\HVWDEOLVKHGWKH*+*UHGXFWLRQWDUJHWRI SHUFHQWRIOHYHOVE\,Q1RYHPEHU&$5%LVVXHGCalifornia’s 2017 Climate Change Scoping Plan:KLOHWKH6WDWHLVRQWUDFNWRH[FHHGWKH$%VFRSLQJSODQWDUJHWV WKLVSODQLVDQXSGDWHWRUHIOHFWWKHHQDFWHG6%UHGXFWLRQWDUJHW 6%ZDVSDVVHGLQZKLFKFRGLILHGD*+*HPLVVLRQVUHGXFWLRQWDUJHWRISHUFHQW EHORZOHYHOV&$5%KDVGUDIWHGD6FRSLQJ3ODQ8SGDWHWRUHIOHFWWKHWDUJHWVHW E\([HFXWLYH2UGHU%DQGFRGLILHGE\6%7KHGUDIWSODQ x,GHQWLILHVDSDWKWRNHHS&DOLIRUQLDRQWUDFNWRPHHWLWV6%*+*UHGXFWLRQWDUJHWRIDW OHDVWSHUFHQWEHORZHPLVVLRQVE\ x,GHQWLILHVDWHFKQRORJLFDOO\IHDVLEOHFRVWHIIHFWLYHSDWKWRDFKLHYHFDUERQQHXWUDOLW\E\ RUHDUOLHU x)RFXVHV RQ VWUDWHJLHV IRU UHGXFLQJ &DOLIRUQLD¶V GHSHQGHQF\ RQ SHWUROHXP WR SURYLGH FRQVXPHUVZLWKFOHDQHQHUJ\RSWLRQVWKDWDGGUHVVFOLPDWHFKDQJHLPSURYHDLUTXDOLW\DQG VXSSRUWHFRQRPLFJURZWKDQGFOHDQVHFWRUMREV x,QWHJUDWHVHTXLW\DQGSURWHFWLQJ&DOLIRUQLD¶VPRVWLPSDFWHGFRPPXQLWLHVDVDGULYLQJ SULQFLSOH x,QFRUSRUDWHVWKHFRQWULEXWLRQRIQDWXUDODQGZRUNLQJODQGVWRWKHVWDWH¶V*+*HPLVVLRQV DVZHOODVLWVUROHLQDFKLHYLQJFDUERQQHXWUDOLW\ x5HOLHVRQWKHPRVWXSWRGDWHVFLHQFHLQFOXGLQJWKHQHHGWRGHSOR\DOOYLDEOHWRROV LQFOXGLQJFDUERQFDSWXUHDQGVHTXHVWUDWLRQDVZHOODGLUHFWDLUFDSWXUH x(YDOXDWHVPXOWLSOHRSWLRQVIRUDFKLHYLQJRXU*+*DQGFDUERQQHXWUDOLW\WDUJHWVDVZHOODV WKHSXEOLFKHDOWKEHQHILWVDQGHFRQRPLFLPSDFWVDVVRFLDWHGZLWKHDFK 7KHGUDIW6FRSLQJ3ODQ8SGDWHZDVSXEOLVKHGRQ0D\DQGRQFHILQDOZLOOOD\RXWKRZ WKHVWDWHFDQJHWWRFDUERQQHXWUDOLW\E\RUHDUOLHU,WLVDOVRWKHILUVW6FRSLQJ3ODQWKDWDGGV FDUERQQHXWUDOLW\DVDVFLHQFHEDVHGJXLGHDQGWRXFKVWRQHEH\RQGVWDWXWRULO\HVWDEOLVKHGHPLVVLRQ UHGXFWLRQWDUJHWV 7KHPLGWHUPWDUJHWLVFRQVLGHUHGFULWLFDOE\&$5%RQWKHSDWKWRREWDLQLQJDQHYHQGHHSHU *+*HPLVVLRQVWDUJHWRISHUFHQWEHORZOHYHOVE\DVGLUHFWHGLQ([HFXWLYH2UGHU6 7KH'UDIW6FRSLQJ3ODQRXWOLQHVWKHVXLWHRISROLF\PHDVXUHVUHJXODWLRQVSODQQLQJ HIIRUWVDQGLQYHVWPHQWVLQFOHDQWHFKQRORJLHVDQGLQIUDVWUXFWXUHSURYLGLQJDEOXHSULQWWRFRQWLQXH GULYLQJGRZQ*+*HPLVVLRQVDQGWRQRWRQO\REWDLQWKHVWDWHZLGHJRDOVEXWFRVWHIIHFWLYHO\ DFKLHYHFDUERQQHXWUDOLW\E\RUHDUOLHU,QWKHGUDIW6FRSLQJ3ODQ&$5%UHFRPPHQGV &DOLIRUQLD$LU5HVRXUFH%RDUGCalifornia’s 2017 Climate Change Scoping Plan: The Strategy for Achieving California’s 2030 Greenhouse Gas Targets. 1RYHPEHU:HE KWWSVZZDUEFDJRYVLWHVGHIDXOWILOHVFODVVLFFFVFRSLQJSODQVFRSLQJBSODQBSGI KWWSVZZDUEFDJRYRXUZRUNSURJUDPVDEFOLPDWHFKDQJHVFRSLQJSODQVFRSLQJSODQGRFXPHQWV x907SHUFDSLWDUHGXFHGEHORZOHYHOVE\DQGEHORZOHYHOVE\ xRI/LJKWGXW\YHKLFOHVDOHVDUH]HURHPLVVLRQVYHKLFOHV=(9E\ xRIPHGLXPGXW\KHDY\GXW\YHKLFOHVDOHVDUH=(9E\ xRISDVVHQJHUDQGRWKHUORFRPRWLYHVDOHVDUH=(9E\ xRIOLQHKDXOORFRPRWLYHVDOHVDUH=(9E\ x$OO HOHFWULF DSSOLDQFHV LQ QHZ UHVLGHQWLDO DQG FRPPHUFLDO EXLOGLQJ EHJLQQLQJ UHVLGHQWLDODQGFRPPHUFLDO xRIUHVLGHQWLDODSSOLDQFHVDOHVDUHHOHFWULFE\DQGRIUHVLGHQWLDODSSOLDQFH VDOHVDUHHOHFWULFE\ xRIFRPPHUFLDODSSOLDQFHVDOHVDUHHOHFWULFE\DQGRIFRPPHUFLDODSSOLDQFH VDOHVDUHHOHFWULFE\ Executive Order B-55-18 – Carbon Neutrality ,QDQHZVWDWHZLGHJRDOZDVHVWDEOLVKHGWRDFKLHYHFDUERQQHXWUDOLW\DVVRRQDVSRVVLEOHEXW QRODWHUWKDQDQGWRPDLQWDLQQHWQHJDWLYHHPLVVLRQVWKHUHDIWHU&$5%DQGRWKHUUHOHYDQW VWDWHDJHQFLHVDUHWDVNHGZLWKHVWDEOLVKLQJVHTXHVWUDWLRQWDUJHWVDQGFUHDWHSROLFLHVSURJUDPVWKDW ZRXOGPHHWWKLVJRDO Senate Bill 375 – California's Regional Transportation and Land Use Planning Efforts (2008) &DOLIRUQLDHQDFWHGOHJLVODWLRQ6%WRH[SDQGWKHHIIRUWVRI$%E\FRQWUROOLQJLQGLUHFW*+* HPLVVLRQV FDXVHG E\ XUEDQ VSUDZO 6% SURYLGHV LQFHQWLYHV IRU ORFDO JRYHUQPHQWV DQG DSSOLFDQWVWRLPSOHPHQWQHZFRQVFLHQWLRXVO\SODQQHGJURZWKSDWWHUQV7KLVLQFOXGHVLQFHQWLYHVIRU FUHDWLQJDWWUDFWLYHZDONDEOHDQGVXVWDLQDEOHFRPPXQLWLHVDQGUHYLWDOL]LQJH[LVWLQJFRPPXQLWLHV 7KHOHJLVODWLRQDOVRDOORZVDSSOLFDQWVWRE\SDVVFHUWDLQHQYLURQPHQWDOUHYLHZVXQGHU&(4$LIWKH\ EXLOGSURMHFWVFRQVLVWHQWZLWKWKHQHZVXVWDLQDEOHFRPPXQLW\VWUDWHJLHV'HYHORSPHQWRIPRUH DOWHUQDWLYHWUDQVSRUWDWLRQRSWLRQVWKDWZRXOGUHGXFHYHKLFOHWULSVDQGPLOHVWUDYHOHGDORQJZLWK WUDIILFFRQJHVWLRQZRXOGEHHQFRXUDJHG6%HQKDQFHV&$5%¶VDELOLW\WRUHDFKWKH$% JRDOV E\ GLUHFWLQJ WKH DJHQF\ LQ GHYHORSLQJ UHJLRQDO *+* HPLVVLRQ UHGXFWLRQWDUJHWV WR EH DFKLHYHGIURPWKHWUDQVSRUWDWLRQVHFWRUIRUDQG&$5%ZRUNVZLWKWKHPHWURSROLWDQ SODQQLQJRUJDQL]DWLRQVHJ$VVRFLDWLRQRI%D\$UHD*RYHUQPHQWV>$%$*@DQG0HWURSROLWDQ 7UDQVSRUWDWLRQ&RPPLVVLRQ>07&@WRDOLJQWKHLUUHJLRQDOWUDQVSRUWDWLRQKRXVLQJDQGODQGXVH SODQVWRUHGXFHYHKLFOHPLOHVWUDYHOHGDQGGHPRQVWUDWHWKHUHJLRQ VDELOLW\WRDWWDLQLWV*+* UHGXFWLRQWDUJHWV$VLPLODUSURFHVVLVXVHGWRUHGXFHWUDQVSRUWDWLRQHPLVVLRQVRIR]RQHSUHFXUVRU SROOXWDQWVLQWKH%D\$UHD Senate Bill 350 - Renewable Portfolio Standards ,Q 6HSWHPEHU WKH &DOLIRUQLD /HJLVODWXUH SDVVHG 6% ZKLFK LQFUHDVHV WKH VWDWHV 5HQHZDEOHV3RUWIROLR6WDQGDUG536IRUFRQWHQWRIHOHFWULFDOJHQHUDWLRQIURPWKHSHUFHQW WDUJHWIRUWRDSHUFHQWUHQHZDEOHVWDUJHWE\ Senate Bill 100 – Current Renewable Portfolio Standards ,Q6HSWHPEHU6%ZDVVLJQHGE\*RYHUQRU%URZQWRUHYLVH&DOLIRUQLD¶V536SURJUDP JRDOVIXUWKHULQJ&DOLIRUQLD¶VIRFXVRQXVLQJUHQHZDEOHHQHUJ\DQGFDUERQIUHHSRZHUVRXUFHVIRU LWVHQHUJ\QHHGV7KHELOOZRXOGUHTXLUHDOO&DOLIRUQLDXWLOLWLHVWRVXSSO\DVSHFLILFSHUFHQWDJHRI WKHLUUHWDLOVDOHVIURPUHQHZDEOHUHVRXUFHVE\FHUWDLQWDUJHW\HDUV%\'HFHPEHU SHUFHQWRIWKHUHWDLOVVDOHVZRXOGQHHGWREHIURPUHQHZDEOHHQHUJ\VRXUFHVE\'HFHPEHU WKHWDUJHWZRXOGEHSHUFHQWE\'HFHPEHUWKHWDUJHWZRXOGEHSHUFHQWDQG E\'HFHPEHUWKHWDUJHWZRXOGEHSHUFHQW%\'HFHPEHUDOO&DOLIRUQLD XWLOLWLHVZRXOGEHUHTXLUHGWRVXSSO\UHWDLOHOHFWULFLW\WKDWLVSHUFHQWFDUERQIUHHDQGVRXUFHG IURPHOLJLEOHUHQHZDEOHHQHUJ\UHVRXUFHWRDOO&DOLIRUQLDHQGXVHFXVWRPHUV California Building Standards Code – Title 24 Part 11 & Part 6 7KH &DOLIRUQLD *UHHQ %XLOGLQJ 6WDQGDUGV &RGH &$/*UHHQ &RGH LVSDUWRIWKH&DOLIRUQLD %XLOGLQJ6WDQGDUGV&RGHXQGHU7LWOH3DUW7KH&$/*UHHQ&RGHHQFRXUDJHVVXVWDLQDEOH FRQVWUXFWLRQVWDQGDUGVWKDWLQYROYHSODQQLQJGHVLJQHQHUJ\HIILFLHQF\ZDWHUHIILFLHQF\UHVRXUFH HIILFLHQF\ DQG HQYLURQPHQWDO TXDOLW\ 7KHVH JUHHQ EXLOGLQJ VWDQGDUG FRGHV DUH PDQGDWRU\ VWDWHZLGHDQGDUHDSSOLFDEOHWRUHVLGHQWLDODQGQRQUHVLGHQWLDOGHYHORSPHQWV7KHPRVWUHFHQW &$/*UHHQ&RGH&DOLIRUQLD%XLOGLQJ6WDQGDUG&RGHZDVHIIHFWLYHDVRI-DQXDU\ 7KH&DOLIRUQLD%XLOGLQJ(QHUJ\(IILFLHQF\6WDQGDUGV&DOLIRUQLD(QHUJ\&RGHLVXQGHU7LWOH 3DUWDQGLVRYHUVHHQE\WKH&DOLIRUQLD(QHUJ\&RPPLVVLRQ&(&7KLVFRGHLQFOXGHVGHVLJQ UHTXLUHPHQWVWRFRQVHUYHHQHUJ\LQQHZUHVLGHQWLDODQGQRQUHVLGHQWLDOGHYHORSPHQWVZKLOHEHLQJ FRVWHIIHFWLYHIRUKRPHRZQHUV7KLV(QHUJ\&RGHLVHQIRUFHGDQGYHULILHGE\FLWLHVGXULQJWKH SODQQLQJDQGEXLOGLQJSHUPLWSURFHVV7KHFXUUHQWHQHUJ\HIILFLHQF\VWDQGDUGV(QHUJ\&RGH UHSODFHGWKH(QHUJ\&RGHDVRI-DQXDU\8QGHUWKHVWDQGDUGVVLQJOHIDPLO\ KRPHVDUHSUHGLFWHGWREHSHUFHQWPRUHHIILFLHQWWKDQKRPHVEXLOWXQGHUWKHVWDQGDUGGXH PRUH VWULQJHQW HQHUJ\HIILFLHQF\ VWDQGDUGV DQG PDQGDWRU\ LQVWDOODWLRQ RI VRODU SKRWRYROWDLF V\VWHPV)RUQRQUHVLGHQWLDOGHYHORSPHQWVLWLVSUHGLFWHGWKDWWKHVHEXLOGLQJVZLOOXVHSHUFHQW OHVVHQHUJ\GXHWROLJKWHQLQJXSJUDGHV &(&VWXGLHVKDYHLGHQWLILHGWKHPRVWDJJUHVVLYHHOHFWULILFDWLRQVFHQDULRDVSXWWLQJWKHEXLOGLQJ VHFWRU RQ WUDFN WR UHDFK WKH FDUERQ QHXWUDOLW\ JRDO E\ ,QVWDOOLQJ QHZ QDWXUDO JDV LQIUDVWUXFWXUHLQQHZEXLOGLQJVZLOOLQWHUIHUHZLWKWKLVJRDO7RPHHWWKH6WDWH¶VJRDOFRPPXQLWLHV KDYHEHHQDGRSWLQJ³5HDFK´FRGHVWKDWSURKLELWQDWXUDOJDVFRQQHFWLRQVLQQHZDQGUHPRGHOHG EXLOGLQJV 5HTXLUHPHQWVIRU(9FKDUJLQJLQIUDVWUXFWXUHDUHVHWIRUWKLQ7LWOHRIWKH&DOLIRUQLD&RGHRI 5HJXODWLRQVDQGDUHUHJXODUO\XSGDWHGRQD\HDUF\FOH7KH&$/*UHHQVWDQGDUGVFRQVLVWRIDVHW RIPDQGDWRU\VWDQGDUGVUHTXLUHGIRUQHZGHYHORSPHQWDVZHOODVWZRPRUHYROXQWDU\VWDQGDUGV 6HHKWWSVZZZGJVFDJRY%6&5HVRXUFHV3DJH&RQWHQW%XLOGLQJ6WDQGDUGV&RPPLVVLRQ5HVRXUFHV/LVW )ROGHU&$/*UHHQaWH[W &$/*UHHQLVWKHILUVW'LQWROHYHOVE\ 6HHKWWSVZZZHQHUJ\FDJRYVLWHVGHIDXOWILOHV7LWOHBBB%XLOGLQJB6WDQGDUGVB)$4BDGDSGI &DOLIRUQLD(QHUJ\&RPPLVVLRQ)inal Commission Report: California Building Decarbonization Assessment. Publication Number CEC-400-2021-006-CMF$XJXVW NQRZQDV7LHUDQG7LHU7KH&DO*UHHQVWDQGDUGVKDYHUHFHQWO\EHHQXSGDWHGYHUVLRQWR UHTXLUHGHSOR\PHQWRIDGGLWLRQDO(9FKDUJHUVLQYDULRXVEXLOGLQJW\SHVLQFOXGLQJPXOWLIDPLO\ UHVLGHQWLDODQGQRQUHVLGHQWLDOODQGXVHV7KH\LQFOXGHUHTXLUHPHQWVIRUERWK(9FDSDEOHSDUNLQJ VSDFHV DQG WKH LQVWDOODWLRQ RI /HYHO (9 VXSSO\ HTXLSPHQW IRUPXOWLIDPLO\ UHVLGHQWLDO DQG QRQUHVLGHQWLDO EXLOGLQJV 7KH &$/*UHHQ VWDQGDUGV LQFOXGH UHTXLUHPHQWV IRU ERWK (9 UHDGLQHVVDQGWKHDFWXDOLQVWDOODWLRQRI(9FKDUJHUV7KH&$/*UHHQVWDQGDUGVLQFOXGHERWK PDQGDWRU\UHTXLUHPHQWVDQGPRUHDJJUHVVLYHYROXQWDU\7LHUDQG7LHUSURYLVLRQV3URYLGLQJ (9FKDUJLQJLQIUDVWUXFWXUHWKDWPHHWVFXUUHQW&$/*UHHQUHTXLUHPHQWVZLOOQRWEHVXIILFLHQWWR SRZHUWKHDQWLFLSDWHGPRUHH[WHQVLYHOHYHORI(9SHQHWUDWLRQLQWKHIXWXUHWKDWLVQHHGHGWRPHHW 6%FOLPDWHJRDOV SB 743 Transportation Impacts 6HQDWH%LOOUHTXLUHGOHDGDJHQFLHVWRDEDQGRQWKHROG³OHYHORIVHUYLFH´PHWULFIRUHYDOXDWLQJ DSURMHFW¶VWUDQVSRUWDWLRQLPSDFWVZKLFKZDVEDVHGVROHO\RQWKHDPRXQWRIGHOD\H[SHULHQFHGE\ PRWRUYHKLFOHV,QUHVSRQVHWKH*RYHUQRU¶V2IILFHRI3ODQQLQJDQG5HVHDUFK235GHYHORSHGD 907 PHWULF WKDW FRQVLGHUHG RWKHU IDFWRUV VXFK DV UHGXFLQJ *+* HPLVVLRQV DQG GHYHORSLQJ PXOWLPRGDOWUDQVSRUWDWLRQ$907SHUFDSLWDPHWULFZDVDGRSWHGLQWRWKH&(4$*XLGHOLQHV 6HFWLRQLQ1RYHPEHU*LYHQFXUUHQWEDVHOLQHSHUFDSLWD907OHYHOVFRPSXWHGE\ &$5%LQWKH6FRSLQJ3ODQRIPLOHVSHUGD\IRUOLJKWGXW\YHKLFOHVDQGPLOHVSHU GD\IRUDOOYHKLFOHW\SHVWKHUHGXFWLRQVQHHGHGWRDFKLHYHWKHFOLPDWHJRDODUHSHUFHQW IRUOLJKWGXW\YHKLFOHVDQGSHUFHQWIRUDOOYHKLFOHW\SHVFRPELQHG%DVHGRQWKLVDQDO\VLVDV ZHOODVRWKHUIDFWRUV235UHFRPPHQGHGXVLQJDSHUFHQWUHGXFWLRQLQSHUFDSLWD907DVDQ DSSURSULDWHWKUHVKROGRIVLJQLILFDQFHIRUHYDOXDWLQJWUDQVSRUWDWLRQLPSDFWV Advanced Clean Cars 7KH$GYDQFHG&OHDQ&DUV3URJUDPRULJLQDOO\DGRSWHGE\&$5%LQZDVGHVLJQHGWREULQJ WRJHWKHU&$5%¶VWUDGLWLRQDOSDVVHQJHUYHKLFOHUHTXLUHPHQWVWRPHHWIHGHUDODLUTXDOLW\VWDQGDUGV DQGDOVRVXSSRUW&DOLIRUQLD¶V$%JRDOVWRGHYHORSDQGLPSOHPHQWSURJUDPVWRUHGXFH*+* HPLVVLRQVEDFNGRZQWROHYHOVE\DJRDODFKLHYHGLQDVDUHVXOWRIQXPHURXV HPLVVLRQVUHGXFWLRQSURJUDPV 7KLVUHFHQWUXOHAdvanced Clean Cars II (ACC II)LVSKDVHWZRRIWKHRULJLQDOUXOH$&&,, HVWDEOLVKHVD\HDUE\\HDUSURFHVVVWDUWLQJLQVRDOOQHZFDUVDQGOLJKWWUXFNVVROGLQ &DOLIRUQLDZLOOEH]HURHPLVVLRQYHKLFOHVE\LQFOXGLQJSOXJLQK\EULGHOHFWULFYHKLFOHV7KH UHJXODWLRQFRGLILHVWKHOLJKWGXW\YHKLFOHJRDOVVHWRXWLQ*RYHUQRU1HZVRP¶V([HFXWLYH2UGHU1 &XUUHQWO\SHUFHQWRIQHZOLJKWGXW\YHKLFOHVVROGLQ&DOLIRUQLDDUH]HURHPLVVLRQVRU SOXJLQK\EULGV%\SHUFHQWRIQHZYHKLFOHVVROGLQ&DOLIRUQLDZRXOGEH]HURHPLVVLRQV DQGSHUFHQWE\ *RYHUQRU¶V2IILFHRI3ODQQLQJDQG5HVHDUFKTechnical Advisory on Evaluating Transportation Impacts in CEQA'HFHPEHU &LW\RI6RXWK6DQ)UDQFLVFR&OLPDWH$FWLRQ3ODQ $OVRDGRSWHGLQ2FWREHUWKH&LW\RI6RXWK6DQ)UDQFLVFR¶V&OLPDWH$FWLRQ3ODQ&$3ZDV GHYHORSHGDORQJVLGHWKH2FWREHUXSGDWHWRWKH&LW\¶V*HQHUDO3ODQ7KHXSGDWHG&$3 H[WHQGVWKHKRUL]RQ\HDUWRDQGVHWVDORQJWHUPJRDORIFDUERQQHXWUDOLW\E\WRDOLJQ ZLWK6WDWHWDUJHWV7KHXSGDWHG&$3DLPVWRDFKLHYHWKHIROORZLQJ $FKLHYHFDUERQQHXWUDOLW\E\UHGXFHHPLVVLRQVE\DQGE\ (TXLWDEO\PLWLJDWHDQGDGGUHVVWKHLPSDFWVRIFOLPDWHFKDQJH 5HDOL]H WKH FREHQHILWV RI FOLPDWH PLWLJDWLRQ DFWLRQV WKDW KHOS FUHDWH D VXVWDLQDEOH FRPPXQLW\ 7RDFKLHYHWKHVHJRDOVWKH&$3LQFOXGHVYDULRXVVWUDWHJLHVDQGDFWLRQVWRUHGXFHJUHHQKRXVHJDV HPLVVLRQV7KHIROORZLQJDUHVWUDWHJLHVDQGDFWLRQVWKDWPD\EHLPSOHPHQWHGFLW\ZLGHZKLFKFRXOG LQGLUHFWO\DSSO\WRWKLVSURSRVHGSURMHFW BNC 1.1,PSURYHWKHHQHUJ\HIILFLHQF\RIQHZFRQVWUXFWLRQ3URYLGHDFRPELQDWLRQRI ILQDQFLDO DQG GHYHORSPHQW SURFHVV LQFHQWLYHV HJ ([SHGLWHG SHUPLWWLQJ )$5 LQFUHDVHHWFWRHQFRXUDJHQHZGHYHORSPHQWWRH[FHHG7LWOHHQHUJ\HIILFLHQF\ VWDQGDUG BNC 2.1$OO(OHFWULF 5HDFK &RGH IRU 1RQUHVLGHQWLDO 1HZ &RQVWUXFWLRQ,PSOHPHQW UHVLGHQWLDO DOOHOHFWULF UHDFK FRGH DQG DGRSW DOOHOHFWULF UHDFK FRGH IRU QRQUHVLGHQWLDOQHZFRQVWUXFWLRQ BE 1.3(QHUJ\ (IILFLHQF\ 3URJUDPV8SGDWH ]RQLQJ DQG EXLOGLQJ FRGHV WR UHTXLUH DOWHUQDWLRQVRUDGGLWLRQVDWOHDVWWKHVL]HRIWKHRULJLQDOEXLOGLQJWRFRPSO\ ZLWKPLQLPXP&$/*UHHQUHTXLUHPHQWV BE 2.4$OO(OHFWULF 0DMRU 5HQRYDWLRQV$GRSW DQ DOOHOHFWULF UHDFK FRGH IRU PDMRU UHQRYDWLRQVDOWHUDWLRQVDGGLWLRQV TL 2.27'0 3URJUDP ,PSOHPHQWPRQLWRU DQG HQIRUFH FRPSOLDQFH ZLWKWKH &LW\¶V 7'02UGLQDQFH TL 2.6&RPSOHWH6WUHHWV3ROLF\(QVXUHWKDWDOOURDGZD\DQGGHYHORSPHQWSURMHFWVDUH GHVLJQHGDQGHYDOXDWHGWRPHHWWKHQHHGVRIDOOVWUHHWXVHUVDQGWKDWGHYHORSPHQW SURMHFWVFRQWULEXWHWRPXOWLPRGDOLPSURYHPHQWVLQSURSRUWLRQWRWKHLUSRWHQWLDO LPSDFWV RQ YHKLFOH PLOHV WUDYHOHG ,QFRUSRUDWH ELF\FOH DQG SHGHVWULDQ LPSURYHPHQWVLGHQWLILHGLQWKH$FWLYH6RXWK&LW\3ODQ WW 2.1,QGRRU:DWHU(IILFLHQF\6WDQGDUGV5HTXLUHKLJKHIILFLHQF\IL[WXUHVLQDOOQHZ FRQVWUXFWLRQDQGPDMRUUHQRYDWLRQVFRPSDUDEOHWR&DO*UHHQ7LHURUVWDQGDUGV &LW\RI6RXWK6DQ)UDQFLVFR85/KWWSVVKDSHVVIFRPZS FRQWHQWXSORDGV66)&$3B$GRSWHG5HVROXWLRQSGI %$$40'*+*6LJQLILFDQFH7KUHVKROGV 2Q$SULO%$$40'DGRSWHGQHZWKUHVKROGVRIVLJQLILFDQFHIRURSHUDWLRQDO*+* HPLVVLRQV IURP ODQG XVH SURMHFWV IRU SURMHFWV EHJLQQLQJ WKH &(4$ SURFHVV 7KH IROORZLQJ IUDPHZRUN LV KRZ %$$40' ZLOO GHWHUPLQH *+* VLJQLILFDQFH PRYLQJIRUZDUG1RWH %$$40'LQWHQGVWKDWWKHWKUHVKROGVDSSO\WRSURMHFWVWKDWEHJLQWKH&(4$SURFHVVDIWHUDGRSWLRQ RIWKHWKUHVKROGVXQOHVVRWKHUZLVHGLUHFWHGE\WKHOHDGDJHQF\7KHQHZWKUHVKROGVRIVLJQLILFDQFH DUH $3URMHFWVPXVWLQFOXGHDWDPLQLPXPWKHIROORZLQJSURMHFWGHVLJQHOHPHQWV D%XLOGLQJV L7KHSURMHFWZLOOQRWLQFOXGHQDWXUDOJDVDSSOLDQFHVRUQDWXUDOJDVSOXPELQJLQERWK UHVLGHQWLDODQGQRQUHVLGHQWLDOGHYHORSPHQW LL7KHSURMHFWZLOOQRWUHVXOWLQDQ\ZDVWHIXOLQHIILFLHQWRUXQQHFHVVDU\HQHUJ\XVDJH DV GHWHUPLQHG E\ WKH DQDO\VLV UHTXLUHG XQGHU &(4$ 6HFWLRQ E DQG 6HFWLRQERIWKH6WDWH&(4$*XLGHOLQHV E7UDQVSRUWDWLRQ L$FKLHYHDUHGXFWLRQLQSURMHFWJHQHUDWHGYHKLFOHPLOHVWUDYHOHG907EHORZWKH UHJLRQDO DYHUDJH FRQVLVWHQW ZLWKWKH FXUUHQW YHUVLRQ RI WKH &DOLIRUQLD &OLPDWH &KDQJH6FRSLQJ3ODQFXUUHQWO\SHUFHQWRUPHHWDORFDOO\DGRSWHG6HQDWH%LOO 907WDUJHWUHIOHFWLQJWKHUHFRPPHQGDWLRQVSURYLGHGLQWKH*RYHUQRU¶V2IILFH RI 3ODQQLQJ DQG 5HVHDUFK¶V 7HFKQLFDO $GYLVRU\ RQ (YDOXDWLQJ 7UDQVSRUWDWLRQ ,PSDFWVLQ&(4$ 5HVLGHQWLDO3URMHFWVSHUFHQWEHORZWKHH[LVWLQJ907SHUFDSLWD 2IILFH3URMHFWVSHUFHQWEHORZWKHH[LVWLQJ907SHUHPSOR\HH 5HWDLO3URMHFWVQRQHWLQFUHDVHLQH[LVWLQJ907 LL$FKLHYH FRPSOLDQFH ZLWK RIIVWUHHW HOHFWULF YHKLFOH UHTXLUHPHQWV LQ WKH PRVW UHFHQWO\DGRSWHGYHUVLRQRI&$/*UHHQ7LHU %%HFRQVLVWHQWZLWKDORFDO*+*UHGXFWLRQVWUDWHJ\WKDWPHHWVWKHFULWHULDXQGHU6WDWH&(4$ *XLGHOLQHV6HFWLRQE $Q\QHZODQGXVHSURMHFWZRXOGKDYHWRLQFOXGHHLWKHUVHFWLRQ$RU%IURPWKHDERYHOLVWQRWERWK WREHFRQVLGHUHGLQFRPSOLDQFHZLWK%$$40'¶V*+*WKUHVKROGVRIVLJQLILFDQFH$VVKRZQLQ ,PSDFW*+*WKHSURMHFWLVFRPSO\LQJZLWKVHFWLRQ%IURPWKLVOLVW ,PSDFW*+* *HQHUDWHJUHHQKRXVHJDVHPLVVLRQVHLWKHUGLUHFWO\RULQGLUHFWO\WKDW PD\KDYHDVLJQLILFDQWLPSDFWRQWKHHQYLURQPHQW" *+*HPLVVLRQVDVVRFLDWHGZLWKGHYHORSPHQWRIWKHSURSRVHGSURMHFWZRXOGRFFXURYHUWKHVKRUW WHUPIURPFRQVWUXFWLRQDFWLYLWLHVFRQVLVWLQJSULPDULO\RIHPLVVLRQVIURPHTXLSPHQWH[KDXVWDQG ZRUNHUDQGYHQGRUWULSV7KHUHZRXOGDOVREHORQJWHUPRSHUDWLRQDOHPLVVLRQVDVVRFLDWHGZLWK YHKLFXODUWUDIILFZLWKLQWKHSURMHFWYLFLQLW\HQHUJ\DQGZDWHUXVDJHDQGVROLGZDVWHGLVSRVDO -XVWLILFDWLRQ5HSRUW%$$40'&(4$7KUHVKROGVIRU(YDOXDWLQJWKH6LJQLILFDQFHRI&OLPDWH,PSDFWVIURP/DQG 8VH3URMHFWDQG3ODQV:HEKWWSVZZZEDDTPGJRYaPHGLDILOHVSODQQLQJDQGUHVHDUFKFHTDFHTDWKUHVKROGV MXVWLILFDWLRQUHSRUWSGISGI"OD HQ (PLVVLRQVIRUWKHSURSRVHGSURMHFWDUHGLVFXVVHGEHORZDQGZHUHDQDO\]HGXVLQJWKHPHWKRGRORJ\ UHFRPPHQGHGLQWKH%$$40'&(4$$LU4XDOLW\*XLGHOLQHV &DO((0RG0RGHOLQJ &DO((0RGZDVXVHGWRSUHGLFW*+*HPLVVLRQVIURPRSHUDWLRQRIWKHVLWHDVVXPLQJIXOOEXLOGRXW RIWKHSURMHFW7KHSURMHFWODQGXVHW\SHVDQGVL]HDQGRWKHUSURMHFWVSHFLILFLQIRUPDWLRQZHUHLQSXW WRWKHPRGHODVGHVFULEHGDERYHZLWKLQWKHFRQVWUXFWLRQSHULRGHPLVVLRQV&DO((0RGRXWSXWLV LQFOXGHGLQAttachment 1 &RQVWUXFWLRQ*+*(PLVVLRQV *+*HPLVVLRQVDVVRFLDWHGZLWKFRQVWUXFWLRQZHUHFRPSXWHGDW07RI&2HIRUWKHWRWDO FRQVWUXFWLRQSHULRG7KHVHDUHWKHHPLVVLRQVIURPRQVLWHRSHUDWLRQRIFRQVWUXFWLRQHTXLSPHQW YHQGRUDQGKDXOLQJWUXFNWULSVDQGZRUNHUWULSV1HLWKHUWKH&LW\QRU%$$40'KDYHDQDGRSWHG WKUHVKROGRIVLJQLILFDQFHIRUFRQVWUXFWLRQUHODWHG*+*HPLVVLRQVWKRXJK%$$40'UHFRPPHQGV TXDQWLI\LQJ HPLVVLRQV DQG GLVFORVLQJ WKDW *+* HPLVVLRQV ZRXOG RFFXU GXULQJ FRQVWUXFWLRQ %$$40' DOVR HQFRXUDJHV WKH LQFRUSRUDWLRQ RI EHVW PDQDJHPHQW SUDFWLFHV WR UHGXFH *+* HPLVVLRQVGXULQJFRQVWUXFWLRQZKHUHIHDVLEOHDQGDSSOLFDEOH&RQVWUXFWLRQHPLVVLRQVKDYHEHHQ DPRUWL]HGRYHUWKHDYHUDJH\HDUOLIHVSDQRIDEXLOGLQJDQGDGGHGWRWKHRSHUDWLRQDOHPLVVLRQV IRUWKLVDQDO\VLV 2SHUDWLRQDO*+*(PLVVLRQV 7KH&DO((0RGPRGHODORQJZLWKWKHSURMHFWYHKLFOHWULSJHQHUDWLRQUDWHVZDVXVHGWRHVWLPDWH GDLO\HPLVVLRQVDVVRFLDWHGZLWKRSHUDWLRQRIWKHIXOO\GHYHORSHGVLWHXQGHUWKHSURSRVHGSURMHFW $VVKRZQLQ7DEOHDQQXDO*+*HPLVVLRQVUHVXOWLQJIURPRSHUDWLRQRIWKHSURSRVHGSURMHFWDUH SUHGLFWHGWREHDQHWRI07RI&2HLQ 7DEOH$QQXDO3URMHFW*+*(PLVVLRQV&2HLQ0HWULF7RQV 6RXUFH&DWHJRU\([LVWLQJ8VHLQ 3URSRVHG3URMHFW LQ1HW,QFUHDVH &RQVWUXFWLRQ$PRUWL]HG $UHD (QHUJ\&RQVXPSWLRQ 0RELOH 6WDWLRQDU\ 6ROLG:DVWH*HQHUDWLRQ :DWHU8VDJH 7RWDO07&2H\HDU ,PSDFW*+* &RQIOLFWZLWKDQDSSOLFDEOHSODQSROLF\RUUHJXODWLRQDGRSWHGIRUWKH SXUSRVHRIUHGXFLQJWKHHPLVVLRQVRIJUHHQKRXVHJDVHV" )RUWKLVLPSDFWWREHFRQVLGHUHGOHVVWKDQVLJQLILFDQWLWPXVWEHFRQVLVWHQWZLWKDORFDO*+* UHGXFWLRQVWUDWHJ\RUPHHWWKHPLQLPXPSURMHFWGHVLJQHOHPHQWVUHFRPPHQGHGE\%$$40' 7KH&LW\¶V&$3ZDVGHYHORSHGDORQJVLGHWKH2FWREHUXSGDWHWRWKH&LW\¶V*HQHUDO3ODQ 7KH(,5SURYLGHGWKHHQYLURQPHQWDOUHYLHZDQGVXEVHTXHQWSXEOLFUHYLHZSURFHVVWKDWZRXOG TXDOLI\WKHXSGDWHG&$3XQGHU&(4$*XLGHOLQHV6HFWLRQE)XUWKHUWKH&$3 TXDQWLILHG*+*HPLVVLRQVLQWKH6RXWK6DQ)UDQFLVFRDUHDHVWDEOLVKHGDOHYHOZKHUHHPLVVLRQV IURPDFWLYLWLHVLQWKH6RXWK6DQ)UDQFLVFRDUHDZRXOGQRWEHFXPXODWLYHO\FRQVLGHUDEOH LGHQWLILHG*+*HPLVVLRQVUHVXOWLQJIURPDFWLRQVZLWKLQWKH6RXWK6DQ)UDQFLVFRDUHDVSHFLILHG SURMHFWOHYHOPHDVXUHVWRDFKLHYHWKHHPLVVLRQVOHYHOVSHFLILHGE\WKH&$3DQGHVWDEOLVKHGDVHW WLPHSHULRGWRPRQLWRUWKH&$3VSURJUHVVWRZDUGVDFKLHYLQJWKHHPLVVLRQVOHYHOVSHFLILHG$V VXFKWKH&LW\¶V&$3LVFRQVLGHUHGDTXDOLILHG*+*UHGXFWLRQVWUDWHJ\XQGHU&(4$*XLGHOLQHV 6HFWLRQE)XUWKHUPRUHWKH3URMHFWPHHWVWKHSURMHFWOHYHOWKUHVKROGV UHFRPPHQGHGE\%$$40'7KH3URMHFWZRXOGEHHQHUJ\HIILFLHQWDQGQRWXWLOL]HQDWXUDOJDV LQFOXGH(9FKDUJLQJVWDWLRQVFRQVLVWHQWZLWKWKHUHTXLUHPHQWVXQGHU6HFWLRQRIWKH &LW\¶V0XQLFLSDO&RGHDQGWKH&DO*UHHQ7LHUUHTXLUHPHQWVDWWKHWLPHRISURMHFWDSSOLFDWLRQ DQGKDV907SHUHPSOR\HHRIDIWHU7'0SODQLPSOHPHQWDWLRQPRUHWKDQEHORZWKH H[LVWLQJUHJLRQDO907SHUHPSOR\HH &RQFOXVLRQ*+*DQG*+* 7KHSURMHFWLVFRQVLGHUHGWRKDYHOHVVWKDQVLJQLILFDQWLPSDFWVIURP*+*HPLVVLRQVEHFDXVHLWLV FRQVLVWHQWZLWKWKHQHZO\DGRSWHG&OLPDWH$FWLRQ3ODQDTXDOLILHGSODQXQGHU&(4$*XLGHOLQHV 6HFWLRQE2SHUDWLRQDO*+*HPLVVLRQVDQDO\]HGE\WKH(,5ZHUHIRXQGWRKDYHOHVV WKDQVLJQLILFDQWLPSDFWV 6XSSRUWLQJ'RFXPHQWDWLRQ Attachment 1LVWKHPHWKRGRORJ\XVHGWRFRPSXWHFRPPXQLW\ULVNLPSDFWVLQFOXGLQJWKHPHWKRGV WRFRPSXWHOLIHWLPHFDQFHUULVNIURPH[SRVXUHWRSURMHFWHPLVVLRQV Attachment 2LQFOXGHVWKH&DO((0RGRXWSXWIRUSURMHFWFRQVWUXFWLRQHPLVVLRQV$OVRLQFOXGHGDUH DQ\PRGHOLQJDVVXPSWLRQV Attachment 3 LQFOXGHVWKH(0)$&HPLVVLRQVPRGHOLQJ7KHLQSXWILOHVIRUWKHVHFDOFXODWLRQV DUHYROXPLQRXVDQGDUHDYDLODEOHXSRQUHTXHVWLQGLJLWDOIRUPDW Attachment 4 LV WKH FRQVWUXFWLRQ KHDOWK ULVN DVVHVVPHQW 7KLV LQFOXGHV WKHVXPPDU\ RI WKH GLVSHUVLRQ PRGHOLQJ DQG WKH FDQFHU ULVN FDOFXODWLRQV IRU FRQVWUXFWLRQ $(502' GLVSHUVLRQ PRGHOLQJILOHVIRUWKLVDVVHVVPHQWZKLFKDUHTXLWHYROXPLQRXVDUHDYDLODEOHXSRQUHTXHVWDQG ZRXOGEHSURYLGHGLQGLJLWDOIRUPDW Attachment 5LQFOXGHVWKHFXPXODWLYHFRPPXQLW\ULVNFDOFXODWLRQVPRGHOLQJUHVXOWVDQGKHDOWK ULVNFDOFXODWLRQVIURPVRXUFHVDIIHFWLQJWKHFRQVWUXFWLRQ0(,DQGSURMHFWVLWHUHFHSWRUV $WWDFKPHQW+HDOWK5LVN&DOFXODWLRQ0HWKRGRORJ\ $KHDOWKULVNDVVHVVPHQW+5$IRUH[SRVXUHWR7R[LF$LU&RQWDPLQDWHV7$&VUHTXLUHVWKH DSSOLFDWLRQRIDULVNFKDUDFWHUL]DWLRQPRGHOWRWKHUHVXOWVIURPWKHDLUGLVSHUVLRQPRGHOWRHVWLPDWH SRWHQWLDO KHDOWK ULVN DW HDFK VHQVLWLYH UHFHSWRU ORFDWLRQ 7KH6WDWH RI &DOLIRUQLD 2IILFH RI (QYLURQPHQWDO +HDOWK +D]DUG $VVHVVPHQW 2(++$ DQG &DOLIRUQLD $LU 5HVRXUFHV %RDUG &$5%GHYHORSUHFRPPHQGHGPHWKRGVIRUFRQGXFWLQJKHDOWKULVNDVVHVVPHQWV7KHPRVWUHFHQW 2(++$ ULVN DVVHVVPHQW JXLGHOLQHV ZHUH SXEOLVKHG LQ )HEUXDU\ RI 7KHVH JXLGHOLQHV LQFRUSRUDWH VXEVWDQWLDO FKDQJHV GHVLJQHG WR SURYLGH IRU HQKDQFHG SURWHFWLRQ RI FKLOGUHQ DV UHTXLUHGE\6WDWHODZFRPSDUHGWRSUHYLRXVSXEOLVKHGULVNDVVHVVPHQWJXLGHOLQHV&$5%KDV SURYLGHGDGGLWLRQDOJXLGDQFHRQLPSOHPHQWLQJ2(++$¶VUHFRPPHQGHGPHWKRGV7KLV+5$ XVHGWKH2(++$ULVNDVVHVVPHQWJXLGHOLQHVDQG&$5%JXLGDQFH7KH%$$40'KDV DGRSWHG UHFRPPHQGHG SURFHGXUHV IRU DSSO\LQJ WKH QHZHVW 2(++$ JXLGHOLQHV DV SDUW RI 5HJXODWLRQ5XOH1HZ6RXUFH5HYLHZRI7R[LF$LU&RQWDPLQDQWV([SRVXUHSDUDPHWHUV IURP WKH 2(++$ JXLGHOLQHV DQG WKH UHFHQW %$$40' +5$ *XLGHOLQHVZHUH XVHG LQ WKLV HYDOXDWLRQ &DQFHU5LVN 3RWHQWLDO LQFUHDVHG FDQFHU ULVN IURP LQKDODWLRQ RI 7$&V LV FDOFXODWHG EDVHG RQ WKH 7$& FRQFHQWUDWLRQRYHUWKHSHULRGRIH[SRVXUHLQKDODWLRQGRVHWKH7$&FDQFHUSRWHQF\IDFWRUDQGDQ DJHVHQVLWLYLW\IDFWRUWRUHIOHFWWKHJUHDWHUVHQVLWLYLW\RILQIDQWVDQGFKLOGUHQWRFDQFHUFDXVLQJ 7$&V7KHLQKDODWLRQGRVHGHSHQGVRQDSHUVRQ¶VEUHDWKLQJUDWHH[SRVXUHWLPHDQGIUHTXHQF\DQG GXUDWLRQRIH[SRVXUH7KHVHSDUDPHWHUVYDU\GHSHQGLQJRQWKHDJHRUDJHUDQJHRIWKHSHUVRQV EHLQJH[SRVHGDQGZKHWKHUWKHH[SRVXUHLVFRQVLGHUHGWRRFFXUDWDUHVLGHQWLDOORFDWLRQRURWKHU VHQVLWLYHUHFHSWRUORFDWLRQ 7KHFXUUHQW2(++$JXLGDQFHUHFRPPHQGVWKDWFDQFHUULVNEHFDOFXODWHGE\DJHJURXSVWRDFFRXQW IRUGLIIHUHQWEUHDWKLQJUDWHVDQGVHQVLWLYLW\WR7$&V6SHFLILFDOO\WKH\UHFRPPHQGHYDOXDWLQJ ULVNVIRUWKHWKLUGWULPHVWHURISUHJQDQF\WRDJH]HURDJHV]HURWROHVVWKDQWZRLQIDQWH[SRVXUH DJHVWZRWROHVVWKDQFKLOGH[SRVXUHDQGDJHVWRDGXOWH[SRVXUH$JHVHQVLWLYLW\ IDFWRUV$6)VDVVRFLDWHGZLWKWKHGLIIHUHQWW\SHVRIH[SRVXUHDUHDQ$6)RIIRUWKHWKLUG WULPHVWHUDQGLQIDQWH[SRVXUHVDQ$6)RIIRUDFKLOGH[SRVXUHDQGDQ$6)RIIRUDQDGXOW H[SRVXUH$OVRDVVRFLDWHGZLWKHDFKH[SRVXUHW\SHDUHGLIIHUHQWEUHDWKLQJUDWHVH[SUHVVHGDVOLWHUV SHUNLORJUDPRIERG\ZHLJKWSHUGD\/NJGD\RUOLWHUVSHUNLORJUDPRIERG\ZHLJKWSHUKRXU SHULRGIRUWKHFDVHRIZRUNHURUVFKRROFKLOGH[SRVXUHV$VUHFRPPHQGHGE\WKH%$$40'IRU UHVLGHQWLDOH[SRVXUHVWKSHUFHQWLOHEUHDWKLQJUDWHVDUHXVHGIRUWKHWKLUGWULPHVWHUDQGLQIDQW H[SRVXUHVDQGWKSHUFHQWLOHEUHDWKLQJUDWHVIRUFKLOGDQGDGXOWH[SRVXUHV)RUFKLOGUHQDWVFKRROV DQGGD\FDUHIDFLOLWLHV%$$40'UHFRPPHQGVXVLQJWKHWKSHUFHQWLOHKRXUEUHDWKLQJUDWHV $GGLWLRQDOO\&$5%DQGWKH%$$40'UHFRPPHQGWKHXVHRIDUHVLGHQWLDOH[SRVXUHGXUDWLRQRI 2(++$Air Toxics Hot Spots Program Risk Assessment Guidelines, The Air Toxics Hot Spots Program Guidance Manual for Preparation of Health Risk Assessments2IILFHRI(QYLURQPHQWDO+HDOWK+D]DUG$VVHVVPHQW )HEUXDU\ &$5%Risk Management Guidance for Stationary Sources of Air Toxics-XO\ %$$40'BAAQMD Air Toxics NSR Program Health Risk Assessment ( HRA) Guidelines'HFHPEHU \HDUVIRUVRXUFHVZLWKORQJWHUPHPLVVLRQVHJURDGZD\V)RUZRUNHUVDVVXPHGWREHDGXOWV D\HDUH[SRVXUHSHULRGLVUHFRPPHQGHGE\WKH%$$40')RUVFKRROFKLOGUHQD\HDU H[SRVXUHSHULRGLVUHFRPPHQGHGE\WKH%$$40' 8QGHUSUHYLRXV2(++$DQG%$$40'+5$JXLGDQFHUHVLGHQWLDOUHFHSWRUVDUHDVVXPHGWREH DWWKHLUKRPHKRXUVDGD\RUSHUFHQWRIWKHWLPH,QWKH5LVN$VVHVVPHQW*XLGDQFH 2(++$LQFOXGHVDGMXVWPHQWVWRH[SRVXUHGXUDWLRQWRDFFRXQWIRUWKHIUDFWLRQRIWLPHDWKRPH )$+ZKLFKFDQEHOHVVWKDQSHUFHQWRIWKHWLPHEDVHGRQXSGDWHGSRSXODWLRQDQGDFWLYLW\ VWDWLVWLFV7KH)$+IDFWRUVDUHDJHVSHFLILFDQGDUHIRUWKLUGWULPHVWHURISUHJQDQF\WROHVV WKDQ\HDUVROGIRUDJHVWROHVVWKDQ\HDUVDQGIRUDJHVWR\HDUV8VHRIWKH )$+IDFWRUVLVDOORZHGE\WKH%$$40'LIWKHUHDUHQRVFKRROVLQWKHSURMHFWYLFLQLW\KDYHD FDQFHUULVNRIRQHLQDPLOOLRQRUJUHDWHUDVVXPLQJSHUFHQWH[SRVXUH)$+ )XQFWLRQDOO\FDQFHUULVNLVFDOFXODWHGXVLQJWKHIROORZLQJSDUDPHWHUVDQGIRUPXODV &DQFHU5LVNSHUPLOOLRQ= CPF x Inhalation Dose x ASF x ED/AT x FAH x 106 :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV )$+ )UDFWLRQRIWLPHVSHQWDWKRPHXQLWOHVV ,QKDODWLRQ'RVH Cair x DBR* x A x (EF/365) x 10-6 :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP '%5 GDLO\EUHDWKLQJUDWH/NJERG\ZHLJKWGD\ +U%5 KRXUEUHDWKLQJUDWH/NJERG\ZHLJKWKRXUV $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU 7KHKHDOWKULVNSDUDPHWHUVXVHGLQWKLVHYDOXDWLRQDUHVXPPDUL]HGDVIROORZV Exposure Type Æ ,QIDQW&KLOG$GXOW 3DUDPHWHUAge Range Æ UG 7ULPHVWHU '30&DQFHU3RWHQF\)DFWRUPJNJGD\ ( ( ( ( 'DLO\%UHDWKLQJ5DWH/NJGD\WK3HUFHQWLOH5DWH 'DLO\%UHDWKLQJ5DWH/NJGD\WK3HUFHQWLOH5DWH KRXU%UHDWKLQJ5DWH/NJKRXUVWK3HUFHQWLOH5DWH ,QKDODWLRQ$EVRUSWLRQ)DFWRU $YHUDJLQJ7LPH\HDUV ([SRVXUH'XUDWLRQ\HDUV ([SRVXUH)UHTXHQF\GD\V\HDU $JH6HQVLWLYLW\)DFWRU )UDFWLRQRI7LPHDW+RPH)$+ $QKRXUEUHDWKLQJUDWH+U%5LVXVHGIRUZRUNHUDQGVFKRROFKLOGH[SRVXUHV 1RQ&DQFHU+D]DUGV 1RQFDQFHUKHDOWKULVNLVXVXDOO\GHWHUPLQHGE\FRPSDULQJWKHSUHGLFWHGOHYHORIH[SRVXUHWRD FKHPLFDOWRWKHOHYHORIH[SRVXUHWKDWLVQRWH[SHFWHGWRFDXVHDQ\DGYHUVHHIIHFWVUHIHUHQFH H[SRVXUHOHYHOHYHQWRWKHPRVWVXVFHSWLEOHSHRSOH3RWHQWLDOQRQFDQFHUKHDOWKKD]DUGVIURP 7$&H[SRVXUHDUHH[SUHVVHGLQWHUPVRIDKD]DUGLQGH[+,ZKLFKLVWKHUDWLRRIWKH7$& FRQFHQWUDWLRQWRDUHIHUHQFHH[SRVXUHOHYHO5(/2(++$KDVGHILQHGDFFHSWDEOHFRQFHQWUDWLRQ OHYHOVIRUFRQWDPLQDQWVWKDWSRVHQRQFDQFHUKHDOWKKD]DUGV7$&FRQFHQWUDWLRQVEHORZWKH5(/ DUHQRWH[SHFWHGWRFDXVHDGYHUVHKHDOWKLPSDFWVHYHQIRUVHQVLWLYHLQGLYLGXDOV7KHWRWDO+,LV FDOFXODWHGDVWKHVXPRIWKH+,VIRUHDFK7$&HYDOXDWHGDQGWKHWRWDO+,LVFRPSDUHGWRWKH %$$40'VLJQLILFDQFHWKUHVKROGVWRGHWHUPLQHZKHWKHUDVLJQLILFDQWQRQFDQFHUKHDOWKLPSDFW IURPDSURMHFWZRXOGRFFXU 7\SLFDOO\IRUUHVLGHQWLDOSURMHFWVORFDWHGQHDUURDGZD\VZLWKVXEVWDQWLDO7$&HPLVVLRQVWKH SULPDU\7$&RIFRQFHUQZLWKQRQFDQFHUKHDOWKHIIHFWVLVGLHVHOSDUWLFXODWHPDWWHU'30)RU '30WKHFKURQLFLQKDODWLRQ5(/LVPLFURJUDPVSHUFXELFPHWHUȝJP $QQXDO30&RQFHQWUDWLRQV :KLOHQRWD7$&ILQHSDUWLFXODWHPDWWHU30KDVEHHQLGHQWLILHGE\WKH%$$40'DVD SROOXWDQW ZLWK SRWHQWLDO QRQFDQFHU KHDOWK HIIHFWV WKDW VKRXOGEH LQFOXGHG ZKHQ HYDOXDWLQJ SRWHQWLDOFRPPXQLW\KHDOWKLPSDFWVXQGHUWKH&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW&(4$7KH WKUHVKROGVRIVLJQLILFDQFHIRU30SURMHFWOHYHODQGFXPXODWLYHDUHLQWHUPVRIDQLQFUHDVHLQ WKHDQQXDODYHUDJHFRQFHQWUDWLRQ:KHQFRQVLGHULQJ30LPSDFWVWKHFRQWULEXWLRQIURPDOO VRXUFHVRI30HPLVVLRQVVKRXOGEHLQFOXGHG)RUSURMHFWVZLWKSRWHQWLDOLPSDFWVIURPQHDUE\ ORFDOURDGZD\VWKH30LPSDFWVVKRXOGLQFOXGHWKRVHIURPYHKLFOHH[KDXVWHPLVVLRQV30 JHQHUDWHGIURPYHKLFOHWLUHDQGEUDNHZHDUDQGIXJLWLYHHPLVVLRQVIURPUHVXVSHQGHGGXVWRQWKH URDGV $WWDFKPHQW&DO((0RG0RGHOLQJ,QSXWVDQG2XWSXWV $LU4XDOLW\1RLVH&RQVWUXFWLRQ,QIRUPDWLRQ'DWD5HTXHVW 3URMHFW1DPH 'XEXTXH 6HH(TXLSPHQW7\SH7$%IRUW\SHKRUVHSRZHUDQGORDGIDFWRU 3URMHFW6L]H 1$ 'ZHOOLQJ8QLWV WRWDOSURMHFWDFUHVGLVWXUEHG 1$ VIUHVLGHQWLDO 3LOH'ULYLQJ"< 1$ VIUHWDLO VIRIILFH5 ' 3URMHFWLQFOXGHRQVLWH*(1(5$72525),5(3803GXULQJSURMHFW23(5$7,21 QRWFRQVWUXFWLRQ"<BBBB VIRWKHUVSHFLI\ ,)<(6LI%27+VHSDUDWHYDOXHV! VISDUNLQJJDUDJH VSDFHV .LORZDWWV+RUVHSRZHUBBWRWDOJHQHUDWRUVWRWDON:BBBBBBB VISDUNLQJORW VSDFHV )XHO7\SHBBBB'LHVHOBBBBBBBBB &RQVWUXFWLRQ'D\V WR /RFDWLRQLQSURMHFW3ODQV'HVLUHGLI$YDLODEOH9DULRXV &RQVWUXFWLRQ+RXUV DPWR SP '212708/7,3/<(48,30(17+2856'$<%<7+(48$17,7<2)(48,30(17 4XDQWLW\'HVFULSWLRQ +3 /RDG)DFWRU +RXUVGD\ 7RWDO :RUN 'D\V $YJ +RXUVSHU GD\ +3 $QQXDO +RXUV &RPPHQWV 6LWH3UHSDUDWLRQLQFOXGHVGHPR DQGXQGHUJURXQGXWLOLWLHV6WDUW'DWH 7RWDOSKDVH 2YHUDOO,PSRUW([SRUW9ROXPHV (QG'DWH ([FDYDWRUV 'HPROLWLRQ9ROXPH *HQHUDWRUV 6TXDUHIRRWDJHRIEXLOGLQJVWREHGHPROLVKHG &RPSUHVVRUV or WRWDOWRQVWREHKDXOHG %DFNKRH BBVTXDUHIHHWor %XOOGR]HU' B"B+DXOLQJYROXPHWRQV 3ODWH&RPSDFWRUV %REFDW/RDGHU 6ZHHSHU $Q\SDYHPHQWGHPROLVKHGDQGKDXOHG"BBWRQV *UDGLQJLQFOXGHVVKRULQJDQG OHYHOVRIH[FDYDWLRQ6WDUW'DWH 7RWDOSKDVH $/WRJHWIURPHVWLPDWLQJ (QG'DWH ([FDYDWRUV %DFNKRH %XOOGR]HU' %REFDW/RDGHU 6RLO+DXOLQJ9ROXPH 6ZHHSHU ([SRUWYROXPH FXELF\DUGV" *URXW3XPS ,PSRUWYROXPH FXELF\DUGV" 'ULOO5LJ7LHEDFNGULOOULJ 0RELOH&UDQH 5ROOHU&RPSDFWRU 'HZDWHULQJSXPSVHOHFWULF 1$ 1$ 1$'HZDWHULQ %XLOGLQJ&RQVWUXFWLRQLQFOXGHVDOO FRQVWUXFWLRQIURPERWWRPRI H[FDYDWLRQWRILQLVKHGEXLOGLQJ6WDUW'DWH 7RWDOSKDVH (QG'DWH &HPHQW7UXFNV"BB7RWDO5RXQG7ULSV 0RELOH&UDQH 6N\-DFN/LIW 6SLGHU/LIWHOHFWULF 1$ 1$ 1$ (OHFWULF"<1BB<BBB2WKHUZLVHDVVXPHGGLHVHO &RPSUHVVRUHOHFWULF 1$ 1$ 1$ (OHFWULF"<1BB<BBB2WKHUZLVHDVVXPHGGLHVHO 7RZHU&UDQHHOHFWULF 1$ 1$ 1$ (OHFWULF"<1BB<BBB2WKHUZLVHDVVXPHGGLHVHO :HOGLQJ0DFKLQHHOHFWULF 1$ 1$ 1$ (OHFWULF"<1BB<BBB2WKHUZLVHDVVXPHGGLHVHO %DFNKRH )RUNOLIWHOHFWULF 1$ 1$ 1$ (OHFWULF"<1BB<BBB2WKHUZLVHDVVXPHGGLHVHO 6FLVVRU/LIWHOHFWULF 1$ 1$ 1$ (OHFWULF"<1BB<BBB2WKHUZLVHDVVXPHGGLHVHO 3HUVRQQHO+RLVWHOHFWULF 1$ 1$ 1$ (OHFWULF"<1BB<BBB2WKHUZLVHDVVXPHGGLHVHO 6ZHHSHU 3DYLQJLQFOXGHVVLWH LPSURYHPHQWVKDUGVFDSH ODQGVFDSH6WDUW'DWH 7RWDOSKDVH (QG'DWH %DFNKRH %REFDW/RDGHU $VSKDOW3DYHU 5ROOHU %XOOGR]HU' 3ODWH&RPSDFWRUV 6N\-DFN/LIW 6ZHHSHU WRQVRIDVSKDOWLVDFXELF\DUG ĚĚŝƚŝŽŶĂůWŚĂƐĞƐ 6WDUW'DWH 7RWDOSKDVH 6WDUW'DWH &RPSOHWH$//3RUWLRQVLQ<HOORZ $VSKDOW"BBBFXELF\DUGVRUBBBBURXQGWULSV" hŶŵŝƚŝŐĂƚĞĚ ZK' EKy WDϭϬǆŚĂƵƐƚ WDϮ͘ϱǆŚĂƵƐƚ WDϮ͘ϱ&ƵŐŝƚŝǀĞ KϮĞ zĞĂƌ Dd ϮϬϮϯ Ϭ͘ϭϱ ϭ͘ϯϰ Ϭ͘Ϭϲ Ϭ͘Ϭϱ Ϭ͘Ϭϭ Ϯϰϳ͘ϲϵ ϮϬϮϰ Ϭ͘ϰϵ ϰ͘ϲϰ Ϭ͘ϭϴ Ϭ͘ϭϲ Ϭ͘ϰϬ ϭϭϮϴ͘ϭϵ ϮϬϮϱ Ϭ͘Ϭϴ Ϭ͘ϴϬ Ϭ͘ϬϮ Ϭ͘ϬϮ Ϭ͘ϬϬ ϭϳϮ͘ϴϳ ϮϬϮϲ Ϯ͘ϳϯ ϭ͘ϲϮ Ϭ͘Ϭϱ Ϭ͘Ϭϰ Ϭ͘ϬϬ ϯϯϳ͘Ϯϲ ϮϬϮϳ Ϯ͘ϯϮ Ϭ͘ϱϭ Ϭ͘ϬϮ Ϭ͘Ϭϭ Ϭ͘ϬϬ ϭϬϮ͘ϳϴ ϮϬϮϯ Ϭ͘Ϭϳ Ϭ͘ϴϱ Ϭ͘Ϭϱ Ϭ͘ϬϮ ϱϵϮ͘ϴϭ ϮϬϮϰ Ϭ͘ϭϱ ϭ͘ϵϯ Ϭ͘ϭϭ Ϭ͘Ϭϰ ϭϯϵϬ͘ϴϯ ϮϬϮϱ Ϭ͘ϭϰ ϭ͘ϴϮ Ϭ͘ϭϭ Ϭ͘Ϭϰ ϭϯϱϱ͘ϴϭ ϮϬϮϲ Ϭ͘ϭϯ ϭ͘ϳϮ Ϭ͘ϭϭ Ϭ͘Ϭϰ ϭϰϲϭ͘ϴϭ ϮϬϮϳ Ϭ͘Ϭϯ Ϭ͘ϯϴ Ϭ͘ϬϮ Ϭ͘Ϭϭ ϯϯϮ͘ϯϱ ϮϬϮϯ Ϭ͘ϮϮ Ϯ͘ϭϵ Ϭ͘ϭϬ Ϭ͘Ϭϳ ϴϰϬ͘ϱϭ ϮϬϮϰ Ϭ͘ϲϰ ϲ͘ϱϴ Ϭ͘Ϯϴ Ϭ͘Ϯϭ Ϯϱϭϵ͘ϬϮ ϮϬϮϱ Ϭ͘ϮϮ Ϯ͘ϲϮ Ϭ͘ϭϯ Ϭ͘Ϭϲ ϭϱϮϴ͘ϲϳ ϮϬϮϲ Ϯ͘ϴϲ ϯ͘ϯϰ Ϭ͘ϭϱ Ϭ͘Ϭϵ ϭϳϵϵ͘Ϭϴ ϮϬϮϳ Ϯ͘ϯϱ Ϭ͘ϴϵ Ϭ͘Ϭϰ Ϭ͘ϬϮ ϰϯϱ͘ϭϯ dŽŶƐ ϲ͘Ϯϴ ϭϱ͘ϲϮ Ϭ͘ϳϭ Ϭ͘ϰϱ ϳϭϮϮ͘ϰϬ WŽƵŶĚƐͬtŽƌŬĚĂǇƐ ϮϬϮϯ ϯ͘ϵϳ ϰϬ͘ϭϱ ϭ͘ϵϬ ϭ͘ϯϱ ϭϬϵ ϮϬϮϰ ϰ͘ϴϵ ϱϬ͘ϮϬ Ϯ͘ϭϳ ϭ͘ϲϬ ϮϲϮ ϮϬϮϱ ϭ͘ϲϳ ϮϬ͘Ϭϵ Ϭ͘ϵϲ Ϭ͘ϰϳ Ϯϲϭ ϮϬϮϲ Ϯϭ͘ϴϵ Ϯϱ͘ϲϯ ϭ͘ϭϳ Ϭ͘ϲϲ Ϯϲϭ ϮϬϮϳ ϳϲ͘ϵϰ Ϯϵ͘Ϭϰ ϭ͘ϯϮ Ϭ͘ϴϬ ϲϭ dŚƌĞƐŚŽůĚͲůďƐͬĚĂǇ ϱϰ͘Ϭ ϱϰ͘Ϭ ϴϮ͘Ϭ ϱϰ͘Ϭ WŽƵŶĚƐ ϭϬϵ͘ϯϳ ϭϲϱ͘ϭϬ ϳ͘ϱϯ ϰ͘ϴϳ Ϭ͘ϬϬ ǀĞƌĂŐĞ ϭϯ͘ϭϲ ϯϮ͘ϳϰ ϭ͘ϰϴ Ϭ͘ϵϱ Ϭ͘ϬϬ ϵϱϰ͘ϬϬ dŚƌĞƐŚŽůĚͲůďƐͬĚĂǇ ϱϰ͘Ϭ ϱϰ͘Ϭ ϴϮ͘Ϭ ϱϰ͘Ϭ hŶŵŝƚŝŐĂƚĞĚ ZK' EKy dŽƚĂůWDϭϬ dŽƚĂůWDϮ͘ϱ zĞĂƌ dŽƚĂů ϲ͘ϵϴ Ϯ͘ϴϵ ϰ͘Ϯϴ ϭ͘ϭϲ dŽƚĂů Ϭ͘ϵϱ Ϭ͘ϰϳ Ϭ͘ϲϭ Ϭ͘ϭϲ dŽŶƐͬǇĞĂƌ ϲ͘Ϭϰ Ϯ͘ϰϯ ϯ͘ϲϳ Ϭ͘ϵϵ dŚƌĞƐŚŽůĚͲdŽŶƐͬǇĞĂƌ ϭϬ͘Ϭ ϭϬ͘Ϭ ϭϱ͘Ϭ ϭϬ͘Ϭ WŽƵŶĚƐWĞƌĂǇ ϯϯ͘Ϭϴ ϭϯ͘Ϯϵ ϮϬ͘ϭϭ ϱ͘ϰϱ dŚƌĞƐŚŽůĚͲůďƐͬĚĂǇ ϱϰ͘Ϭ ϱϰ͘Ϭ ϴϮ͘Ϭ ϱϰ͘Ϭ ĂƚĞŐŽƌǇ WƌŽũĞĐƚ ǆŝƐƚŝŶŐ WƌŽũĞĐƚϮϬϯϬ ǆŝƐƚŝŶŐ ƌĞĂ Ϭ͘Ϭϰ Ϭ͘ϬϬ ŶĞƌŐǇ ϭϭϴϳ͘Ϭϱ ϭϰϵ͘ϴϯ DŽďŝůĞ ϯϵϬϯ͘ϬϬ ϲϯϳ͘ϰϱ ^ƚĂƚŝŽŶĂƌǇ Ϯϴϭ͘ϲϵ tĂƐƚĞ ϯϰ͘ϯϵ ϰ͘ϯϰ tĂƚĞƌ Ϯϳϭ͘ϱϬ ϳϲ͘ϬϮ dKd> ϱϲϳϳ͘ϲϴ ϴϲϳ͘ϲϰ EĞƚ','ŵŝƐƐŝŽŶƐ ϰϴϭϬ͘Ϭϰ tŽƌŬĚĂǇƐ dŽƚĂůŽŶƐƚƌƵĐƚŝŽŶŵŝƐƐŝŽŶƐ ŽŶƐƚƌƵĐƚŝŽŶƋƵŝƉŵĞŶƚ dŽƚĂůŽŶƐƚƌƵĐƚŝŽŶŵŝƐƐŝŽŶƐďǇzĞĂƌ KϮĞ dŽŶƐ dŽƚĂůŽŶƐƚƌƵĐƚŝŽŶŵŝƐƐŝŽŶƐ ǀĞƌĂŐĞĂŝůǇŵŝƐƐŝŽŶƐ ŽŶƐƚƌƵĐƚŝŽŶƌŝƚĞƌŝĂŝƌWŽůůƵƚĂŶƚƐ KƉĞƌĂƚŝŽŶĂůƌŝƚĞƌŝĂŝƌWŽůůƵƚĂŶƚƐ dŽŶƐ ǆŝƐƚŝŶŐhƐĞŵŝƐƐŝŽŶƐ EĞƚŶŶƵĂůKƉĞƌĂƚŝŽŶĂůŵŝƐƐŝŽŶƐ ǀĞƌĂŐĞĂŝůǇŵŝƐƐŝŽŶƐ D& >ĂŶĚhƐĞ ^ŝǌĞ ĂŝůǇdƌŝƉƐ EĞǁdƌŝƉƐ tĞĞŬĚĂǇdƌŝƉ'ĞŶ tĞĞŬĚĂǇ ^Ăƚ ^ƵŶZĞƐĞĂƌĐŚΘĞǀĞůŽƉŵĞŶƚ ŬƐĨϵϬϬ ϵϵϳϮ ϲϱϴϮϳ͘ϯϭϭϭ͘Ϯϲ ϭ͘ϵ ϭ͘ϭϭdDZĞĚƵĐƚŝŽŶϯϰйͲϯϯϵϬZĞǀϭ͘Ϯϯ Ϭ͘ϳϮǆŝƐƚŝŶŐZĞƐĞĂƌĐŚΘĞǀĞůŽƉŵĞŶƚ ŬƐĨϭϭϯ͘ϱϵϱ ϵϰϳ ϵϰϳϴ͘ϯϰϭϭ͘Ϯϲ ϭ͘ϵ ϭ͘ϭϭZĞǀϭ͘ϰϭ Ϭ͘ϴϮdƌĂĨĨŝĐŽŶƐƵůƚĂŶƚdƌŝƉ'ĞŶ ĂůDŽĚĞĨĂƵůƚ 2IIURDG(TXLSPHQW3URYLGHGE\FRQVWUXFWLRQZRUNVKHHW(OHFWULFSXPS +3DQG/RDG)DFWRU2IIURDG(TXLSPHQW3URYLGHGE\FRQVWUXFWLRQZRUNVKHHW7ULSVDQG907(0)$&DGMXVWPHQWWULSVSDYHPHQWGHPR WRQVEXLOGLQJFRQVW FRQFUHWHWUXFNURXQGWULSVSDYLQJ F\DVSKDOW'HPROLWLRQ([LVWLQJEXLOGLQJGHPR VTIW&RQVWUXFWLRQ3KDVH3URYLGHGLQFRQVWUXFWLRQZRUNVKHHWPRQWKVRIDUFKFRDWLQJDGGHGIRU52*HPLVVLRQVFDOFXODWLRQV2IIURDG(TXLSPHQW2IIURDG(TXLSPHQW3URYLGHGE\FRQVWUXFWLRQZRUNVKHHW(OHFWULFOLIWVHOHFWULFDLUFRPSUHVVRUVHOHFWULFFUDQHVHOHFWULFIRUNOLIWVHOHFWULFZHOGHUV +3DQG/RDG)DFWRU2IIURDG(TXLSPHQW'HIDXOWHTXLSPHQWVLQFHQRSKDVHSURYLGHG2IIURDG(TXLSPHQW3URYLGHGE\FRQVWUXFWLRQZRUNVKHHW12,QWHQVLW\OE0:KU8VHU(QWHUHG&RPPHQWV 1RQ'HIDXOW'DWD3URMHFW&KDUDFWHULVWLFV/DQG8VH7RWDOVTXDUHIRRWDJHDQGORWDFUHDJHSURYLGHGLQSURMHFWFRQVWUXFWLRQVKHHW8WLOLW\&RPSDQ\3HQLQVXOD&OHDQ(QHUJ\&2,QWHQVLW\OE0:KU&+,QWHQVLW\OE0:KU3UHFLSLWDWLRQ)UHT'D\V&OLPDWH=RQH2SHUDWLRQDO<HDU2WKHU3URMHFW&KDUDFWHULVWLFV8UEDQL]DWLRQ8UEDQ:LQG6SHHGPV(QFORVHG3DUNLQJZLWK(OHYDWRU 6SDFH 5HVHDUFK 'HYHORSPHQW VTIW 'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO3URMHFW&KDUDFWHULVWLFV/DQG8VDJH/DQG8VHV 6L]H 0HWULF /RW$FUHDJH )ORRU6XUIDFH$UHD 3RSXODWLRQ&DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG WEO&RQVW'XVW0LWLJDWLRQ :DWHU8QSDYHG5RDG9HKLFOH6SHHG WEO&RQVW(TXLS0LWLJDWLRQ 1XPEHU2I(TXLSPHQW0LWLJDWHG )OHHW0L[(0)$&IOHHWPL[6DQ0DWHR&RXQW\6WDWLRQDU\6RXUFHV(PHUJHQF\*HQHUDWRUVDQG)LUH3XPSVN:WRWDOKSWRWDOGLHVHOJHQHUDWRUVKUV\U6WDWLRQDU\6RXUFHV(PHUJHQF\*HQHUDWRUVDQG)LUH3XPSV()(PHUJHQF\*HQHUDWRUVDQG)LUH3XPSV()7LHU%$&7HPLVVLRQIDFWRUVIRUJHQHUDWRUV12[30 30 7DEOH1DPH &ROXPQ1DPH 'HIDXOW9DOXH 1HZ9DOXH9HKLFOH7ULSV3URYLGHGWULSJHQZLWKUHGXFWLRQDGMXVWPHQWV9HKLFOH(PLVVLRQ)DFWRUV(0)$&YHKLFOHHPLVVLRQVIDFWRUV6DQ0DWHR&RXQW\(QHUJ\8VH1RUHDFKFRGHSDVVHGIRUQHZQRQUHVLGHQWLDO:DWHU$QG:DVWHZDWHU:DVWHZDWHUWUHDWPHQWDHURELFQRVHSWLFWDQNVRUODJRRQV&RQVWUXFWLRQ2IIURDG(TXLSPHQW0LWLJDWLRQ%03VWLHULQWHULPPLWLJDWLRQ*UDGLQJ*UDGLQJ F\H[SRUWHG &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO)OHHW0L[ /+' H HWEO)OHHW0L[ /+' WEO)OHHW0L[ /+' WEO)OHHW0L[ /'7 WEO)OHHW0L[ /'7 WEO)OHHW0L[ /'7 WEO)OHHW0L[ /'7 WEO)OHHW0L[ /'$ WEO)OHHW0L[ /'$ WEO)OHHW0L[ ++' H HWEO)OHHW0L[ ++' H HWEO&RQVWUXFWLRQ3KDVH 1XP'D\V WEO&RQVWUXFWLRQ3KDVH 1XP'D\V WEO&RQVWUXFWLRQ3KDVH 1XP'D\V WEO&RQVWUXFWLRQ3KDVH 1XP'D\V WEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVWUXFWLRQ3KDVH 1XP'D\V WEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULPWEO&RQVW(TXLS0LWLJDWLRQ 7LHU 1R&KDQJH 7LHU,QWHULP &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO2II5RDG(TXLSPHQW /RDG)DFWRU WEO2II5RDG(TXLSPHQW /RDG)DFWRU WEO2II5RDG(TXLSPHQW +RUVH3RZHU WEO2II5RDG(TXLSPHQW /RDG)DFWRU WEO2II5RDG(TXLSPHQW +RUVH3RZHU WEO2II5RDG(TXLSPHQW +RUVH3RZHU WEO2II5RDG(TXLSPHQW +RUVH3RZHU WEO2II5RDG(TXLSPHQW +RUVH3RZHU WEO/DQG8VH /RW$FUHDJH WEO2II5RDG(TXLSPHQW +RUVH3RZHU WEO/DQG8VH /DQG8VH6TXDUH)HHW WEO/DQG8VH /RW$FUHDJH WEO*UDGLQJ $FUHV2I*UDGLQJ WEO*UDGLQJ 0DWHULDO([SRUWHG WEO)OHHW0L[ 8%86 H HWEO)OHHW0L[ 8%86 H HWEO)OHHW0L[ 6%86 H HWEO)OHHW0L[ 6%86 H HWEO)OHHW0L[ 2%86 H HWEO)OHHW0L[ 2%86 H HWEO)OHHW0L[ 0+' HWEO)OHHW0L[ 0+' HWEO)OHHW0L[ 0+ H HWEO)OHHW0L[ 0+ H HWEO)OHHW0L[ 0'9 WEO)OHHW0L[ 0'9 WEO)OHHW0L[ 0&< WEO)OHHW0L[ 0&< WEO)OHHW0L[ /+' H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30BB() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30BB() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30BB() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30BB() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 12;B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 12;B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 12;B() WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 12;B() WEO2II5RDG(TXLSPHQW 8VDJH+RXUV WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 12;B() WEO2II5RDG(TXLSPHQW 8VDJH+RXUV WEO2II5RDG(TXLSPHQW 8VDJH+RXUV WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW /RDG)DFWRU WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW /RDG)DFWRU WEO2II5RDG(TXLSPHQW /RDG)DFWRU &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO7ULSV$QG907 :RUNHU7ULS1XPEHU WEO7ULSV$QG907 :RUNHU7ULS1XPEHU WEO7ULSV$QG907 :RUNHU7ULS1XPEHU WEO7ULSV$QG907 :RUNHU7ULS1XPEHU WEO7ULSV$QG907 9HQGRU7ULS1XPEHU WEO7ULSV$QG907 :RUNHU7ULS1XPEHU WEO7ULSV$QG907 +DXOLQJ7ULS1XPEHU WEO7ULSV$QG907 +DXOLQJ7ULS1XPEHU WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH 1XPEHU2I(TXLSPHQW WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH 1XPEHU2I(TXLSPHQW WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH 1XPEHU2I(TXLSPHQW WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH 1XPEHU2I(TXLSPHQW WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH 1XPEHU2I(TXLSPHQW WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH 1XPEHU2I(TXLSPHQW WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RXUV3HU<HDU WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RXUV3HU<HDU WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RXUV3HU<HDU WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RXUV3HU<HDU WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RXUV3HU<HDU WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RXUV3HU<HDU WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RUVH3RZHU9DOXH WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RUVH3RZHU9DOXH WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RUVH3RZHU9DOXH WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RUVH3RZHU9DOXH WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RUVH3RZHU9DOXH WEO6WDWLRQDU\*HQHUDWRUV3XPSV8VH +RUVH3RZHU9DOXH WEO6WDWLRQDU\*HQHUDWRUV3XPSV() 30BB() &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H WEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' H WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' H WEO9HKLFOH() ++' &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ HWEO9HKLFOH() /'$ HWEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H WEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< HWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H WEO9HKLFOH() /+' H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 HWEO9HKLFOH() 0'9 HWEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 0+ H WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+ H WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ H WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 HWEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGWEO:DWHU $HURELF3HUFHQW WEO:DWHU $QDHURELFDQG)DFXOWDWLYH/DJRRQV3HUFHQW WEO9HKLFOH7ULSV :'B75 WEO:DWHU $HURELF3HUFHQW WEO9HKLFOH7ULSV 67B75 WEO9HKLFOH7ULSV 68B75 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 HWEO9HKLFOH() 8%86 HWEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 HWEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG12 &2H307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 0D[LPXP H H H H H 12 &2H<HDU WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+2YHUDOO&RQVWUXFWLRQ8QPLWLJDWHG&RQVWUXFWLRQ52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30WEO:DWHU 6HSWLF7DQN3HUFHQW (PLVVLRQV6XPPDU\WEO:DWHU $QDHURELFDQG)DFXOWDWLYH/DJRRQV3HUFHQW WEO:DWHU 6HSWLF7DQN3HUFHQW &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 4XDUWHU 6WDUW'DWH (QG'DWH 0D[LPXP8QPLWLJDWHG52*12;WRQVTXDUWHU 0D[LPXP0LWLJDWHG52*12;WRQVTXDUWHU1 &2H3HUFHQW5HGXFWLRQ 307RWDO%LR&2 1%LR&2 7RWDO&2 &+)XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW3052* 12[ &2 62 0D[LPXP HH H HH H H H H <HDU WRQV\U07\U &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG&+ 12 &2H([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 0LWLJDWHG2SHUDWLRQDO 7RWDO :DWHU :DVWH 6WDWLRQDU\ H 0RELOH H (QHUJ\ H HH HH$UHD H 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+2YHUDOO2SHUDWLRQDO8QPLWLJDWHG2SHUDWLRQDO52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30+LJKHVW &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG $FUHVRI*UDGLQJ6LWH3UHSDUDWLRQ3KDVH$FUHVRI*UDGLQJ*UDGLQJ3KDVH %XLOGLQJ,QWHULRU $UFKLWHFWXUDO&RDWLQJ 3DYLQJ 3DYLQJ %XLOGLQJ&RQVWUXFWLRQ %XLOGLQJ&RQVWUXFWLRQ *UDGLQJ *UDGLQJ 'HPROLWLRQ 'HPROLWLRQ 6WDUW'DWH (QG'DWH 1XP'D\V:HHN1XP'D\V 3KDVH'HVFULSWLRQ&RQVWUXFWLRQ'HWDLO&RQVWUXFWLRQ3KDVH3KDVH1XPEHU3KDVH1DPH 3KDVH7\SH 7RWDO&2 &+ 1 &2H3HUFHQW5HGXFWLRQ 52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30307RWDO%LR&2 1%LR&2 7RWDO :DWHU :DVWH 6WDWLRQDU\ H 0RELOH H (QHUJ\ H HH HH$UHD H &DWHJRU\ WRQV\U07\U &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG%XLOGLQJ&RQVWUXFWLRQ &UDQHV %XLOGLQJ&RQVWUXFWLRQ &UDQHV %XLOGLQJ&RQVWUXFWLRQ $LU&RPSUHVVRUV %XLOGLQJ&RQVWUXFWLRQ $HULDO/LIWV %XLOGLQJ&RQVWUXFWLRQ $HULDO/LIWV *UDGLQJ 7UDFWRUV/RDGHUV%DFNKRHV *UDGLQJ 6ZHHSHUV6FUXEEHUV *UDGLQJ 5XEEHU7LUHG'R]HUV *UDGLQJ 5ROOHUV *UDGLQJ 3XPSV *UDGLQJ 3XPSV *UDGLQJ *UDGHUV *UDGLQJ ([FDYDWRUV *UDGLQJ &UDQHV *UDGLQJ %RUH'ULOO5LJV 'HPROLWLRQ 7UDFWRUV/RDGHUV%DFNKRHV 'HPROLWLRQ 6ZHHSHUV6FUXEEHUV 'HPROLWLRQ 5XEEHU7LUHG'R]HUV 'HPROLWLRQ 3ODWH&RPSDFWRUV 'HPROLWLRQ *HQHUDWRU6HWV 'HPROLWLRQ ([FDYDWRUV 'HPROLWLRQ &RQFUHWH,QGXVWULDO6DZV 'HPROLWLRQ $LU&RPSUHVVRUV $FUHVRI3DYLQJ5HVLGHQWLDO,QGRRU5HVLGHQWLDO2XWGRRU1RQ5HVLGHQWLDO,QGRRU1RQ5HVLGHQWLDO2XWGRRU6WULSHG3DUNLQJ$UHD2II5RDG(TXLSPHQW3KDVH1DPH 2IIURDG(TXLSPHQW7\SH $PRXQW 8VDJH+RXUV +RUVH3RZHU /RDG)DFWRU &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG0LWLJDWLRQ0HDVXUHV&RQVWUXFWLRQ8VH&OHDQHU(QJLQHVIRU&RQVWUXFWLRQ(TXLSPHQW:DWHU([SRVHG$UHD5HGXFH9HKLFOH6SHHGRQ8QSDYHG5RDGV++'7%XLOGLQJ,QWHULRU /'B0L[ +'7B0L[ ++'7 /'B0L[ +'7B0L[3DYLQJ ++'7%XLOGLQJ&RQVWUXFWLRQ /'B0L[ +'7B0L[ ++'7 /'B0L[ +'7B0L[*UDGLQJ +DXOLQJ9HKLFOH&ODVV'HPROLWLRQ /'B0L[ +'7B0L[ ++'77ULSVDQG9073KDVH1DPH 2IIURDG(TXLSPHQW&RXQW:RUNHU7ULS1XPEHU9HQGRU7ULS1XPEHU+DXOLQJ7ULS1XPEHU:RUNHU7ULS/HQJWK9HQGRU7ULS/HQJWK+DXOLQJ7ULS/HQJWK:RUNHU9HKLFOH&ODVV9HQGRU9HKLFOH&ODVV%XLOGLQJ,QWHULRU $LU&RPSUHVVRUV 3DYLQJ 7UDFWRUV/RDGHUV%DFNKRHV 3DYLQJ 6ZHHSHUV6FUXEEHUV 3DYLQJ 5XEEHU7LUHG'R]HUV 3DYLQJ 5ROOHUV 3DYLQJ 3ODWH&RPSDFWRUV 3DYLQJ 3DYLQJ(TXLSPHQW 3DYLQJ 3DYHUV 3DYLQJ $HULDO/LIWV %XLOGLQJ&RQVWUXFWLRQ :HOGHUV %XLOGLQJ&RQVWUXFWLRQ 7UDFWRUV/RDGHUV%DFNKRHV %XLOGLQJ&RQVWUXFWLRQ 6ZHHSHUV6FUXEEHUV %XLOGLQJ&RQVWUXFWLRQ *HQHUDWRU6HWV %XLOGLQJ&RQVWUXFWLRQ )RUNOLIWV &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH H H7RWDO 2II5RDG H H H)XJLWLYH'XVW12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30'HPROLWLRQ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG'HPROLWLRQ 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 0LWLJDWHG&RQVWUXFWLRQ2II6LWH H H7RWDO 2II5RDG H H H)XJLWLYH'XVW12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG0LWLJDWHG&RQVWUXFWLRQ2Q6LWH 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2H 8QPLWLJDWHG&RQVWUXFWLRQ2II6LWHHH H HH H7RWDO H 2II5RDG H HH HH H H H H)XJLWLYH'XVW12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG*UDGLQJ8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2H 0LWLJDWHG&RQVWUXFWLRQ2II6LWHHH H HHH H7RWDO H H 2II5RDG H H HH HH H H H H)XJLWLYH'XVW12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG0LWLJDWHG&RQVWUXFWLRQ2Q6LWH 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH 7RWDO 2II5RDG )XJLWLYH'XVW12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG%XLOGLQJ&RQVWUXFWLRQ8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 0LWLJDWHG&RQVWUXFWLRQ2II6LWH 7RWDO 2II5RDG )XJLWLYH'XVW12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG0LWLJDWHG&RQVWUXFWLRQ2Q6LWH 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 H H 7RWDO H H HH HH HH H HH2II5RDG H 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG12 &2H307RWDO %LR&2 1%LR&2 7RWDO&2 &+%XLOGLQJ&RQVWUXFWLRQ8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2II6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 H H 7RWDO H H HH HH HH H HH2II5RDG H 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO H H 2II5RDG &DWHJRU\ WRQV\U07\U &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG H 2II5RDG 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+%XLOGLQJ&RQVWUXFWLRQ8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2II6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO H H 2II5RDG &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 7RWDO H H 2II5RDG 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG H H 7RWDO H H HH HH HH H HH2II5RDG H 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+%XLOGLQJ&RQVWUXFWLRQ8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2II6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG0LWLJDWHG&RQVWUXFWLRQ2II6LWH H H 7RWDO H H HH HH HH H HH2II5RDG H 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH H 7RWDO 3DYLQJ H 2II5RDG 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+3DYLQJ8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 0LWLJDWHG&RQVWUXFWLRQ2II6LWH H 7RWDO 3DYLQJ H 2II5RDG 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 8QPLWLJDWHG&RQVWUXFWLRQ2II6LWH H 7RWDO 3DYLQJ H 2II5RDG 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+3DYLQJ8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 0LWLJDWHG&RQVWUXFWLRQ2II6LWHHH H HH7RWDO 3DYLQJ HH H HH2II5RDG 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGH 8QPLWLJDWHG&RQVWUXFWLRQ2II6LWHHH H HH7RWDO H 2II5RDG H H HH HH $UFKLW&RDWLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+%XLOGLQJ,QWHULRU8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGH 0LWLJDWHG&RQVWUXFWLRQ2II6LWHHH H HH7RWDO H 2II5RDG H H HH HH $UFKLW&RDWLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGH 8QPLWLJDWHG&RQVWUXFWLRQ2II6LWHHH H HH7RWDO H 2II5RDG H H HH HH $UFKLW&RDWLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+%XLOGLQJ,QWHULRU8QPLWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHGH 0LWLJDWHG&RQVWUXFWLRQ2II6LWHHH H HH7RWDO H 2II5RDG H H HH HH $UFKLW&RDWLQJ 12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG&RQVWUXFWLRQ2Q6LWH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG 8QPLWLJDWHG &2H&DWHJRU\ WRQV\U07\U0LWLJDWHG %LR&2 1%LR&2 7RWDO&2 &+ 12([KDXVW30307RWDO )XJLWLYH30([KDXVW30307RWDO2SHUDWLRQDO'HWDLO0RELOH0LWLJDWLRQ0HDVXUHV0RELOH52* 12[ &2 62 )XJLWLYH30 7RWDO :RUNHU 9HQGRU +DXOLQJ &+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG&+ 12 &2H&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2 (QHUJ\'HWDLO+LVWRULFDO(QHUJ\8VH10LWLJDWLRQ0HDVXUHV(QHUJ\ 5HVHDUFK 'HYHORSPHQW (QFORVHG3DUNLQJZLWK(OHYDWRU 2%86 8%86 0&< 6%86 0+0'9 /+' /+' 0+' ++')OHHW0L[/DQG8VH /'$ /'7 /'7 5HVHDUFK 'HYHORSPHQW (QFORVHG3DUNLQJZLWK(OHYDWRU +6RU&& +2RU&1: 3ULPDU\ 'LYHUWHG 3DVVE\/DQG8VH +:RU&: +6RU&& +2RU&1: +:RU&:7ULS7\SH,QIRUPDWLRQ0LOHV 7ULS 7ULS3XUSRVH7RWDO 5HVHDUFK 'HYHORSPHQW $QQXDO907(QFORVHG3DUNLQJZLWK(OHYDWRU /DQG8VH :HHNGD\ 6DWXUGD\ 6XQGD\ $QQXDO9077ULS6XPPDU\,QIRUPDWLRQ$YHUDJH'DLO\7ULS5DWH 8QPLWLJDWHG 0LWLJDWHG &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG&+ 12 &2H/DQG8VH N%78\U WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&20LWLJDWHG1DWXUDO*DV8VH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30 7RWDO H 5HVHDUFK 'HYHORSPHQWH H (QFORVHG3DUNLQJZLWK(OHYDWRU &+ 12 &2H/DQG8VH N%78\U WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&2(QHUJ\E\/DQG8VH1DWXUDO*DV8QPLWLJDWHG1DWXUDO*DV8VH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30 1DWXUDO*DV8QPLWLJDWHG H H 1DWXUDO*DV0LWLJDWHG (OHFWULFLW\8QPLWLJDWHG (OHFWULFLW\0LWLJDWHG &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG/DQG8VH N:K\UWRQ07\U(QFORVHG3DUNLQJZLWK(OHYDWRUH 0LWLJDWHG(OHFWULFLW\8VH7RWDO&2 &+ 12 &2H 7RWDO 5HVHDUFK 'HYHORSPHQWH /DQG8VH N:K\UWRQ07\U(QFORVHG3DUNLQJZLWK(OHYDWRUH (QHUJ\E\/DQG8VH(OHFWULFLW\8QPLWLJDWHG(OHFWULFLW\8VH7RWDO&2 &+ 12 &2H 7RWDO H 5HVHDUFK 'HYHORSPHQWH H (QFORVHG3DUNLQJZLWK(OHYDWRU &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG $UFKLWHFWXUDO&RDWLQJ&+ 12 &2H6XE&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2H $UHDE\6XE&DWHJRU\8QPLWLJDWHG8QPLWLJDWHG H HH HH H&2H&DWHJRU\ WRQV\U07\U0LWLJDWHG H HH HH%LR&2 1%LR&2 7RWDO&2 &+ 12([KDXVW30307RWDO )XJLWLYH30([KDXVW30307RWDO$UHD'HWDLO0LWLJDWLRQ0HDVXUHV$UHD52* 12[ &2 62 )XJLWLYH30 7RWDO 5HVHDUFK 'HYHORSPHQWH &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG:DWHU'HWDLO0LWLJDWLRQ0HDVXUHV:DWHU H H 7RWDO H HH HH HH HH/DQGVFDSLQJ HH &RQVXPHU3URGXFWV $UFKLWHFWXUDO&RDWLQJ12 &2H6XE&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 H H 7RWDO H HH HH HH HH/DQGVFDSLQJ HH &RQVXPHU3URGXFWV &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG/DQG8VH 0JDOWRQ07\U0LWLJDWHG,QGRRU2XWGRRU8VH7RWDO&2 &+ 12 &2H 7RWDO 5HVHDUFK 'HYHORSPHQW /DQG8VH 0JDOWRQ07\U(QFORVHG3DUNLQJZLWK(OHYDWRU :DWHUE\/DQG8VH8QPLWLJDWHG,QGRRU2XWGRRU8VH7RWDO&2 &+ 12 &2H8QPLWLJDWHG &DWHJRU\WRQ07\U0LWLJDWHG 7RWDO&2 &+ 12 &2H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG/DQG8VH WRQVWRQ07\U:DVWHE\/DQG8VH8QPLWLJDWHG:DVWH'LVSRVHG7RWDO&2 &+ 12 &2H8QPLWLJDWHG WRQ07\U0LWLJDWHG :DVWH'HWDLO0LWLJDWLRQ0HDVXUHV:DVWH&DWHJRU\<HDU7RWDO&2 &+ 12 &2H 7RWDO 5HVHDUFK 'HYHORSPHQW (QFORVHG3DUNLQJZLWK(OHYDWRU &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG/RDG)DFWRU )XHO7\SH(PHUJHQF\*HQHUDWRU 'LHVHO(TXLSPHQW7\SH 1XPEHU +RXUV'D\ +RXUV<HDU +RUVH3RZHU+RUVH3RZHU /RDG)DFWRU )XHO7\SH6WDWLRQDU\(TXLSPHQW)LUH3XPSVDQG(PHUJHQF\*HQHUDWRUV2SHUDWLRQDO2IIURDG(TXLSPHQW7\SH 1XPEHU +RXUV'D\ 'D\V<HDU 7RWDO 5HVHDUFK 'HYHORSPHQW /DQG8VH WRQVWRQ07\U(QFORVHG3DUNLQJZLWK(OHYDWRU 0LWLJDWHG:DVWH'LVSRVHG7RWDO&2 &+ 12 &2H 7RWDO 5HVHDUFK 'HYHORSPHQW (QFORVHG3DUNLQJZLWK(OHYDWRU &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH1RW$SSOLHG9HJHWDWLRQ 7RWDO H H (PHUJHQF\*HQHUDWRU'LHVHO +3 &+ 12 &2H(TXLSPHQW7\SH WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &28VHU'HILQHG(TXLSPHQW(TXLSPHQW7\SH 1XPEHU6WDWLRQDU\6RXUFHV8QPLWLJDWHG0LWLJDWHG 'LHVHO%RLOHUV(TXLSPHQW7\SH 1XPEHU +HDW,QSXW'D\ +HDW,QSXW<HDU %RLOHU5DWLQJ )XHO7\SH(PHUJHQF\*HQHUDWRU 'LHVHO(PHUJHQF\*HQHUDWRU 'LHVHO(PHUJHQF\*HQHUDWRU 'LHVHO(PHUJHQF\*HQHUDWRU 'LHVHO(PHUJHQF\*HQHUDWRU 'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO3URMHFW&KDUDFWHULVWLFV/DQG8VDJH/DQG8VHV 6L]H 0HWULF /RW$FUHDJH )ORRU6XUIDFH$UHD 3RSXODWLRQ&DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG&OLPDWH=RQH2SHUDWLRQDO<HDU8WLOLW\&RPSDQ\3HQLQVXOD&OHDQ(QHUJ\2WKHU3URMHFW&KDUDFWHULVWLFV8UEDQL]DWLRQ8UEDQ:LQG6SHHGPV3UHFLSLWDWLRQ)UHT'D\V5HVHDUFK 'HYHORSPHQW VTIW 7DEOH1DPH &ROXPQ1DPH 'HIDXOW9DOXH 1HZ9DOXHWEO&RQVWUXFWLRQ3KDVH 1XP'D\V 2IIURDG(TXLSPHQW([LVWLQJUXQQRFRQVWUXFWLRQ*UDGLQJ9HKLFOH7ULSV3URYLGHGWULSJHQZLWKUHGXFWLRQDGMXVWPHQWV9HKLFOH(PLVVLRQ)DFWRUV(0)$&YHKLFOHHPLVVLRQVIDFWRUV6DQ0DWHR&RXQW\)OHHW0L[(0)$&IOHHWPL[6DQ0DWHR&RXQW\8VHU(QWHUHG&RPPHQWV 1RQ'HIDXOW'DWD3URMHFW&KDUDFWHULVWLFV/DQG8VH3URYLGHGLQFRQVWUXFWLRQVKHHWDPRXQWRIVTXDUHIRRWDJHRIH[LVWLQJEXLOGLQJVGHPR HG&RQVWUXFWLRQ3KDVH([LVWLQJUXQQRFRQVWUXFWLRQ&2,QWHQVLW\OE0:KU&+,QWHQVLW\OE0:KU12,QWHQVLW\OE0:KUWEO&RQVWUXFWLRQ3KDVH 3KDVH(QG'DWH &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO)OHHW0L[ /'7 WEO)OHHW0L[ /+' WEO)OHHW0L[ /'$ WEO)OHHW0L[ /'7 WEO)OHHW0L[ ++' H HWEO)OHHW0L[ 0+' H HWEO)OHHW0L[ 2%86 H HWEO)OHHW0L[ 0'9 WEO)OHHW0L[ 0+ H HWEO)OHHW0L[ /+' H HWEO)OHHW0L[ 0&< WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 8VDJH+RXUV WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO2II5RDG(TXLSPHQW 2II5RDG(TXLSPHQW8QLW$PRXQW WEO)OHHW0L[ 6%86 H HWEO)OHHW0L[ 8%86 H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO2II5RDG(TXLSPHQW 8VDJH+RXUV WEO2II5RDG(TXLSPHQW 8VDJH+RXUV WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H WEO9HKLFOH() ++' WEO9HKLFOH() ++' H WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() ++' WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() ++' H HWEO9HKLFOH() ++' H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ HWEO9HKLFOH() /'$ HWEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ H HWEO9HKLFOH() /'$ H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'$ WEO9HKLFOH() /'$ WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 HWEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 H HWEO9HKLFOH() /'7 H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /'7 WEO9HKLFOH() /'7 WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H WEO9HKLFOH() /+' H WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H HWEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' H WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() /+' H HWEO9HKLFOH() /+' H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() /+' WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() /+' WEO9HKLFOH() /+' WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< HWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< H HWEO9HKLFOH() 0&< H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0&< WEO9HKLFOH() 0&< WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 HWEO9HKLFOH() 0'9 HWEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 H HWEO9HKLFOH() 0'9 H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H WEO9HKLFOH() 0+ WEO9HKLFOH() 0'9 WEO9HKLFOH() 0'9 WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+ H WEO9HKLFOH() 0+ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ H HWEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+ H WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+ WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 0+' HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H WEO9HKLFOH() 0+' WEO9HKLFOH() 0+' HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' H HWEO9HKLFOH() 0+' H WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 0+' WEO9HKLFOH() 0+' WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 H WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 H WEO9HKLFOH() 2%86 H HWEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 H WEO9HKLFOH() 2%86 WEO9HKLFOH() 2%86 HWEO9HKLFOH() 2%86 &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 2%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 H HWEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 6%86 H WEO9HKLFOH() 6%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 HWEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHGWEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 H HWEO9HKLFOH() 8%86 WEO9HKLFOH() 8%86 H HWEO9HKLFOH7ULSV :'B75 (PLVVLRQV6XPPDU\WEO9HKLFOH7ULSV 67B75 WEO9HKLFOH7ULSV 68B75 WEO9HKLFOH() 8%86 H WEO9HKLFOH() 8%86 2YHUDOO2SHUDWLRQDO8QPLWLJDWHG2SHUDWLRQDO52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW3012 &2H307RWDO %LR&2 1%LR&2 7RWDO&2 &+ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG $UHD H H&DWHJRU\ WRQV\U07\U HH H ((QHUJ\ H HH :DVWH H H H 0RELOH 7RWDO H :DWHU0LWLJDWHG2SHUDWLRQDO52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 HH $UHD H H12 &2H&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+H H 0RELOH HH H H(QHUJ\ H :DWHU :DVWH H 7RWDO H &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG&2 621 &2H3HUFHQW5HGXFWLRQ 307RWDO%LR&2 1%LR&2 7RWDO&2 &+)XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW3052* 12[ $QQXDO9075HVHDUFK 'HYHORSPHQW /DQG8VH :HHNGD\ 6DWXUGD\ 6XQGD\ $QQXDO9077ULS6XPPDU\,QIRUPDWLRQ$YHUDJH'DLO\7ULS5DWH 8QPLWLJDWHG 0LWLJDWHG+6RU&& +2RU&1: 3ULPDU\ 'LYHUWHG 3DVVE\/DQG8VH +:RU&: +6RU&& +2RU&1: +:RU&:7ULS7\SH,QIRUPDWLRQ0LOHV 7ULS 7ULS3XUSRVH7RWDO 2%86 8%86 0&< 6%86 0+0'9 /+' /+' 0+' ++')OHHW0L[/DQG8VH /'$ /'7 /'7 5HVHDUFK 'HYHORSPHQW +LVWRULFDO(QHUJ\8VH10LWLJDWLRQ0HDVXUHV(QHUJ\52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 (QHUJ\'HWDLO 5HVHDUFK 'HYHORSPHQW 12 &2H307RWDO %LR&2 1%LR&2 7RWDO&2 &+ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG (OHFWULFLW\0LWLJDWHG&DWHJRU\ WRQV\U07\U (OHFWULFLW\8QPLWLJDWHG HH HH 1DWXUDO*DV8QPLWLJDWHG H H 1DWXUDO*DV0LWLJDWHG&+ 12 &2H/DQG8VH N%78\U WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&2(QHUJ\E\/DQG8VH1DWXUDO*DV8QPLWLJDWHG1DWXUDO*DV8VH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30 H H7RWDO H H 5HVHDUFK 'HYHORSPHQWH H0LWLJDWHG1DWXUDO*DV8VH52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 H12 &2H/DQG8VH N%78\U WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG H 5HVHDUFK 'HYHORSPHQWH H(QHUJ\E\/DQG8VH(OHFWULFLW\8QPLWLJDWHG(OHFWULFLW\8VH7RWDO&2 &+ 12 &2H H H H7RWDO H 0LWLJDWHG(OHFWULFLW\8VH7RWDO&2 &+ 12 &2H7RWDO /DQG8VH N:K\UWRQ07\U5HVHDUFK 'HYHORSPHQW 7RWDO /DQG8VH N:K\UWRQ07\U5HVHDUFK 'HYHORSPHQW &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG$UHD'HWDLO0LWLJDWLRQ0HDVXUHV$UHD52* 12[ &2 62 )XJLWLYH30&2H&DWHJRU\ WRQV\U07\U0LWLJDWHG H H %LR&2 1%LR&2 7RWDO&2 &+ 12([KDXVW30307RWDO )XJLWLYH30([KDXVW30307RWDOH H$UHDE\6XE&DWHJRU\8QPLWLJDWHGH8QPLWLJDWHG H H HH HHH $UFKLWHFWXUDO&RDWLQJ&+ 12 &2H6XE&DWHJRU\ WRQV\U07\U([KDXVW30307RWDO %LR&2 1%LR&2 7RWDO&262 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH3052* 12[ &2HH H &RQVXPHU3URGXFWV HHH HH H7RWDO H H HH /DQGVFDSLQJ &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG12 &2H6XE&DWHJRU\ WRQV\U07\U307RWDO %LR&2 1%LR&2 7RWDO&2 &+0LWLJDWHG52* 12[ &2 62 )XJLWLYH30([KDXVW30307RWDO )XJLWLYH30([KDXVW30 &RQVXPHU3URGXFWV $UFKLWHFWXUDO&RDWLQJHH /DQGVFDSLQJ HH H :DWHU'HWDLO0LWLJDWLRQ0HDVXUHV:DWHU7RWDO&2 &+ 12 &2HHHH HH H7RWDO H H &DWHJRU\WRQ07\U0LWLJDWHG &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG:DWHUE\/DQG8VH8QPLWLJDWHG,QGRRU2XWGRRU8VH7RWDO&2 &+ 12 &2H8QPLWLJDWHG 0LWLJDWHG,QGRRU2XWGRRU8VH7RWDO&2 &+ 12 &2H7RWDO /DQG8VH 0JDOWRQ07\U5HVHDUFK 'HYHORSPHQW :DVWH'HWDLO7RWDO /DQG8VH 0JDOWRQ07\U5HVHDUFK 'HYHORSPHQW &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG0LWLJDWLRQ0HDVXUHV:DVWH&DWHJRU\<HDU:DVWHE\/DQG8VH8QPLWLJDWHG:DVWH'LVSRVHG7RWDO&2 &+ 12 &2H8QPLWLJDWHG &2HWRQ07\U0LWLJDWHG 7RWDO&2 &+ 12 0LWLJDWHG7RWDO /DQG8VH WRQVWRQ07\U5HVHDUFK 'HYHORSPHQW &DO((0RG9HUVLRQ&DO((0RG 3DJHRI'DWH$0'XEXTXH$YH66)([LVWLQJ6DQ0DWHR&RXQW\$QQXDO(0)$&2II0RGHO$GMXVWPHQW)DFWRUVIRU*DVROLQH/LJKW'XW\9HKLFOHWR$FFRXQWIRUWKH6$)(9HKLFOH5XOH$SSOLHG:DVWH'LVSRVHG7RWDO&2 &+ 12 &2H'D\V<HDU +RUVH3RZHU /RDG)DFWRU )XHO7\SH6WDWLRQDU\(TXLSPHQW 2SHUDWLRQDO2IIURDG(TXLSPHQW7\SH 1XPEHU +RXUV'D\7RWDO /DQG8VH WRQVWRQ07\U5HVHDUFK 'HYHORSPHQW 8VHU'HILQHG(TXLSPHQW(TXLSPHQW7\SH 1XPEHU9HJHWDWLRQ+RUVH3RZHU /RDG)DFWRU )XHO7\SH%RLOHUV(TXLSPHQW7\SH 1XPEHU +HDW,QSXW'D\ +HDW,QSXW<HDU %RLOHU5DWLQJ )XHO7\SH)LUH3XPSVDQG(PHUJHQF\*HQHUDWRUV(TXLSPHQW7\SH 1XPEHU +RXUV'D\ +RXUV<HDU $WWDFKPHQW(0)$&&DOFXODWLRQV WŽůůƵƚĂŶƚƐZK' EKǆ K ^KϮ&ƵŐŝƚŝǀĞWDϭϬǆŚĂƵƐƚWDϭϬWDϭϬdŽƚĂů&ƵŐŝƚŝǀĞWDϮ͘ϱǆŚĂƵƐƚWDϮ͘ϱWDϮ͘ϱdŽƚĂů EŝŽͲKϮ ,ϰ EϮK KϮĞzZϮϬϮϯ Ϭ͘Ϭϲϳϰ Ϭ͘ϴϱϭϴ ϭ͘Ϭϭϱϲ Ϭ͘ϬϬϱϳ Ϭ͘ϮϮϰϲ Ϭ͘Ϭϰϱϴ Ϭ͘ϮϳϬϰ Ϭ͘Ϭϯϯϴ Ϭ͘Ϭϭϵϭ Ϭ͘ϬϱϮϵ ϱϲϵ͘ϵϲϰϰ Ϭ͘ϬϲϮϲ Ϭ͘Ϭϳϭϰ ϱϵϮ͘ϴϭϰϭϮϬϮϰ Ϭ͘ϭϰϵϯ ϭ͘ϵϯϭϰ Ϯ͘ϯϭϭϵ Ϭ͘Ϭϭϯϱ Ϭ͘ϱϯϳϯ Ϭ͘ϭϬϴϲ Ϭ͘ϲϰϱϵ Ϭ͘ϬϴϬϴ Ϭ͘ϬϰϱϬ Ϭ͘ϭϮϱϴ ϭϯϯϳ͘ϯϬϳϰ Ϭ͘ϭϰϰϬ Ϭ͘ϭϲϳϱ ϭϯϵϬ͘ϴϯϰϮϮϬϮϱ Ϭ͘ϭϯϴϱ ϭ͘ϴϭϵϴ Ϯ͘ϭϵϳϯ Ϭ͘Ϭϭϯϭ Ϭ͘ϱϯϱϵ Ϭ͘ϭϬϳϰ Ϭ͘ϲϰϯϮ Ϭ͘ϬϴϬϲ Ϭ͘Ϭϰϰϭ Ϭ͘ϭϮϰϳ ϭϯϬϯ͘ϳϮϰϭ Ϭ͘ϭϯϲϰ Ϭ͘ϭϲϯϯ ϭϯϱϱ͘ϴϬϲϭϮϬϮϲ Ϭ͘ϭϮϵϰ ϭ͘ϳϮϬϴ Ϯ͘ϭϬϲϭ Ϭ͘ϬϭϮϴ Ϭ͘ϱϯϱϵ Ϭ͘ϭϬϲϳ Ϭ͘ϲϰϮϲ Ϭ͘ϬϴϬϲ Ϭ͘Ϭϰϯϱ Ϭ͘ϭϮϰϭ ϭϰϬϱ͘ϳϵϱϬ Ϭ͘ϭϰϮϴ Ϭ͘ϭϳϲϬ ϭϰϲϭ͘ϴϭϬϰϮϬϮϳ Ϭ͘ϬϮϴϰ Ϭ͘ϯϳϵϯ Ϭ͘ϰϳϬϵ Ϭ͘ϬϬϮϵ Ϭ͘ϭϮϰϴ Ϭ͘ϬϮϰϳ Ϭ͘ϭϰϵϱ Ϭ͘Ϭϭϴϴ Ϭ͘ϬϭϬϬ Ϭ͘ϬϮϴϴ ϯϭϵ͘ϲϰϵϲ Ϭ͘Ϭϯϭϰ Ϭ͘ϬϰϬϬ ϯϯϮ͘ϯϰϳϰϮϬϮϯ Ϭ͘ϬϱϮϰ Ϭ͘ϮϬϮϵ Ϭ͘ϯϮϮϯ Ϭ͘ϬϬϬϳ Ϭ͘ϬϮϬϲ Ϭ͘ϬϬϰϭ Ϭ͘ϬϮϰϳ Ϭ͘ϬϬϯϭ Ϭ͘ϬϬϭϴ Ϭ͘ϬϬϰϵ ϲϱ͘ϭϮϮϮ Ϭ͘Ϭϭϭϳ Ϭ͘ϬϬϵϯ ϲϴ͘ϭϳϭϳϮϬϮϰ Ϭ͘ϭϭϳϬ Ϭ͘ϰϳϭϰ Ϭ͘ϳϯϯϬ Ϭ͘ϬϬϭϱ Ϭ͘Ϭϰϵϰ Ϭ͘ϬϬϵϳ Ϭ͘ϬϱϵϬ Ϭ͘ϬϬϳϰ Ϭ͘ϬϬϰϮ Ϭ͘Ϭϭϭϲ ϭϱϮ͘ϴϴϴϳ Ϭ͘ϬϮϲϵ Ϭ͘ϬϮϭϳ ϭϲϬ͘ϬϭϳϭϮϬϮϱ Ϭ͘ϭϬϵϰ Ϭ͘ϰϱϰϮ Ϭ͘ϲϵϲϳ Ϭ͘ϬϬϭϱ Ϭ͘ϬϰϵϮ Ϭ͘ϬϬϵϱ Ϭ͘Ϭϱϴϳ Ϭ͘ϬϬϳϰ Ϭ͘ϬϬϰϭ Ϭ͘Ϭϭϭϱ ϭϰϵ͘Ϯϭϵϵ Ϭ͘ϬϮϱϲ Ϭ͘ϬϮϭϭ ϭϱϲ͘ϭϰϴϮϮϬϮϲ Ϭ͘ϭϬϯϬ Ϭ͘ϰϯϴϴ Ϭ͘ϲϲϳϰ Ϭ͘ϬϬϭϱ Ϭ͘ϬϰϵϮ Ϭ͘ϬϬϵϰ Ϭ͘Ϭϱϴϲ Ϭ͘ϬϬϳϰ Ϭ͘ϬϬϰϬ Ϭ͘Ϭϭϭϰ ϭϲϭ͘Ϭϲϯϳ Ϭ͘ϬϮϲϵ Ϭ͘ϬϮϮϳ ϭϲϴ͘ϱϭϭϮϮϬϮϳ Ϭ͘ϬϮϮϴ Ϭ͘Ϭϵϴϲ Ϭ͘ϭϰϵϰ Ϭ͘ϬϬϬϯ Ϭ͘Ϭϭϭϱ Ϭ͘ϬϬϮϮ Ϭ͘Ϭϭϯϲ Ϭ͘ϬϬϭϳ Ϭ͘ϬϬϬϵ Ϭ͘ϬϬϮϲ ϯϲ͘ϲϲϳϵ Ϭ͘ϬϬϲϬ Ϭ͘ϬϬϱϮ ϯϴ͘ϯϱϳϯ^ƵŵŵĂƌǇŽĨŽŶƐƚƌƵĐƚŝŽŶdƌĂĨĨŝĐŵŝƐƐŝŽŶƐ;D&ϮϬϮϭͿdŽŶƐƌŝƚĞƌŝĂWŽůůƵƚĂŶƚƐdŽǆŝĐŝƌŽŶƚĂŵŝŶĂŶƚƐ;ϭDŝůĞdƌŝƉ>ĞŶŐƚŚͿDĞƚƌŝĐdŽŶƐ WŚĂƐĞĂůDŽĚtKZ<ZdZ/W^ĂůDŽĚsEKZdZ/W^dŽƚĂůtŽƌŬĞƌdƌŝƉƐdŽƚĂůsĞŶĚŽƌdƌŝƉƐĂůDŽĚ,h>/E'dZ/W^tŽƌŬĞƌdƌŝƉ>ĞŶŐƚŚsĞŶĚŽƌdƌŝƉ>ĞŶŐƚŚ,ĂƵůŝŶŐdƌŝƉ>ĞŶŐƚŚtŽƌŬĞƌsĞŚŝĐůĞůĂƐƐsĞŶĚŽƌsĞŚŝĐůĞůĂƐƐ,ĂƵůŝŶŐsĞŚŝĐůĞůĂƐƐtŽƌŬĞƌsDdsĞŶĚŽƌsDd,ĂƵůŝŶŐsDdĞŵŽůŝƚŝŽŶϮϴ ϬϯϯϲϬ Ϭϱϯϵ͘ϰϭϬ͘ϴ ϳ͘ϯ ϮϬ >ͺDŝǆ ,dͺDŝǆ ,,d ϯϲϮϴϴ Ϭ ϭϬϳϴϴ'ƌĂĚŝŶŐϰϯ ϬϭϬϬϲϮ Ϭϰϭ͕ϯϳϱϭϬ͘ϴ ϳ͘ϯ ϮϬ >ͺDŝǆ ,dͺDŝǆ ,,d ϭϬϴϲϲϵ͘ϲ Ϭ ϴϮϳϱϬϬƵŝůĚŝŶŐŽŶƐƚƌƵĐƚŝŽŶϱϱϳ ϮϱϮϯϭϯϱϵϭ ϭϰϭϴϳϲϭϲϴϬϬϭϬ͘ϴ ϳ͘ϯ ϮϬ >ͺDŝǆ ,dͺDŝǆ ,,d ϯϯϴϲϳϴϯ ϭϬϯϱϲϵϱ ϯϯϲϬϬϬWĂǀŝŶŐϮϬ ϬϯϲϮϬ ϬϮϲϳϭϬ͘ϴ ϳ͘ϯ ϮϬ >ͺDŝǆ ,dͺDŝǆ ,,d ϯϵϬϵϲ Ϭ ϱϯϰϬƵŝůĚŝŶŐ/ŶƚĞƌŝŽƌϭϭϭ ϬϭϰϰϯϬ ϬϬϭϬ͘ϴ ϳ͘ϯ ϮϬ >ͺDŝǆ ,dͺDŝǆ ,,d ϭϱϱϴϰϰ Ϭ ϬϮϬϮϯ ϴͬϭͬϮϯ ϭϮͬϯϭͬϮϯ ϭϱϯ ϭϬϵϮϬϮϰ ϭͬϭͬϮϰ ϭϮͬϯϭͬϮϰ ϯϲϲ ϮϲϮϮϬϮϱ ϭͬϭͬϮϱ ϭϮͬϯϭͬϮϱ ϯϲϱ ϮϲϭϮϬϮϲ ϭͬϭͬϮϲ ϭϮͬϯϭͬϮϬϮϲ ϯϲϱ ϮϲϭϮϬϮϳϭͬϭͬϮϬϮϳ ϯͬϮϲͬϮϬϮϳϴϱ ϲϭϭϯϯϰϵϱϰdŽƚĂůtŽƌŬĚĂǇƐWŚĂƐĞ ^ƚĂƌƚĂƚĞ ŶĚĂƚĞ ĂǇƐͬtĞĞŬ tŽƌŬĚĂǇƐĞŵŽůŝƚŝŽŶ ϴͬϭͬϮϬϮϯ ϭͬϭϱͬϮϬϮϰϱϭϮϬ'ƌĂĚŝŶŐ ϭͬϭϲͬϮϬϮϰ ϭϮͬϲͬϮϬϮϰϱϮϯϰƵŝůĚŝŶŐŽŶƐƚƌƵĐƚŝŽŶ ϭϮͬϳͬϮϬϮϰ ϮͬϯͬϮϬϮϳϱϱϲϯWĂǀŝŶŐ ϳͬϭϳͬϮϬϮϲ ϯͬϮϲͬϮϬϮϳϱϭϴϭƵŝůĚŝŶŐ/ŶƚĞƌŝŽƌϵͬϮϲͬϮϬϮϲ ϯͬϮϲͬϮϬϮϳ ϱϭϯϬEƵŵďĞƌŽĨĂǇƐWĞƌzĞĂƌĂůDŽĚŽŶƐƚƌƵĐƚŝŽŶ/ŶƉƵƚƐ ^ŽƵƌĐĞ͗D&ϮϬϮϭ;ǀϭ͘Ϭ͘ϮͿŵŝƐƐŝŽŶZĂƚĞƐZĞŐŝŽŶdǇƉĞ͗ŽƵŶƚǇZĞŐŝŽŶ͗^ĂŶDĂƚĞŽĂůĞŶĚĂƌzĞĂƌ͗ϮϬϮϮ^ĞĂƐŽŶ͗ŶŶƵĂůsĞŚŝĐůĞůĂƐƐŝĨŝĐĂƚŝŽŶ͗D&ϮϬϬϳĂƚĞŐŽƌŝĞƐhŶŝƚƐ͗ŵŝůĞƐͬĚĂǇĨŽƌsDdĂŶĚsDd͕ƚƌŝƉƐͬĚĂǇĨŽƌdƌŝƉƐ͕ŐͬŵŝůĞĨŽƌZhEy͕WDtĂŶĚWDdt͕ŐͬƚƌŝƉĨŽƌ^dZy͕,Kd^K<ĂŶĚZhE>K^^͕ŐͬǀĞŚŝĐůĞͬĚĂǇĨŽƌ/>yĂŶĚ/hZE͘W,sĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŽƚĂůsDd͘ZĞŐŝŽŶ ĂůĞŶĚĂƌz sĞŚŝĐůĞĂƚDŽĚĞůzĞĂ ^ƉĞĞĚ &ƵĞů WŽƉƵůĂƚŝŽŶdŽƚĂůsDd sDd sDd dƌŝƉƐ EKǆͺZhEEKǆͺ/>yEKǆͺ^dZyWDϮ͘ϱͺZh WDϮ͘ϱͺ/>WDϮ͘ϱͺ^dZWDϮ͘ϱͺWDWDϮ͘ϱͺWDWDϭϬͺZhEWDϭϬͺ/>WDϭϬͺ^dZ WDϭϬͺWDdWDϭϬͺWDKϮͺZhEKϮͺ/>yKϮͺ^dZy,ϰͺZhE,ϰͺ/>y,ϰͺ^dZyEϮKͺZhEEϮKͺ/>yEϮKͺ^dZyZK'ͺZhEZK'ͺ/>yZK'ͺ^dZyZK'ͺ,Kd^ZK'ͺZhE>ZK'ͺ/hZdK'ͺZhEdK'ͺ/>ydK'ͺ^dZydK'ͺ,Kd^dK'ͺZhE>dK'ͺ/hZ E,ϯͺZhEKͺZhEyKͺ/>y Kͺ^dZy ^KǆͺZhE ^Kǆͺ/>y ^Kǆͺ^dZy^ĂŶDĂƚĞŽ ϮϬϮϮ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϰ͘Ϯϲϭϳϵ ϲϬϳ͘ϱϮϵϱ ϲϬϳ͘ϱϮϵϱ Ϭ ϴϱ͘Ϯϲϵϴϵ ϰ͘ϮϭϳϮϬϵ Ϭ Ϭ͘ϬϬϮϴϭ Ϭ͘ϬϬϭϰϲ Ϭ Ϭ͘ϬϬϬϵϯϱ Ϭ͘ϬϬϱ Ϭ͘ϬϯϭϮϱϴ Ϭ͘ϬϬϭϱϴϴ Ϭ Ϭ͘ϬϬϭϬϭϳ Ϭ͘ϬϮ Ϭ͘ϬϴϵϯϬϴ ϮϮϳϲ͘ϴϳϲ Ϭ ϱϰ͘ϵϴϬϬϵ Ϭ͘ϭϭϲϵϬϲ Ϭ Ϭ͘ϬϬϬϭϭϵ Ϭ͘ϭϱϭϱϲϯ Ϭ Ϭ͘ϬϬϬϭϯϱ Ϭ͘ϲϬϭϬϵ Ϭ Ϭ͘ϬϬϬϲϰϰ Ϭ͘Ϭϰϴϰϳϴ Ϭ͘ϰϬϬϭϱϯ ϯ͘ϰϲϵϲϲϯ Ϭ͘ϴϳϳϭϬϴ Ϭ Ϭ͘ϬϬϬϳϬϱ Ϭ͘Ϭϰϴϰϳϴ Ϭ͘ϰϬϬϭϱϯ ϯ͘ϰϲϵϲϲϯ Ϭ͘Ϭϰϱ ϯϯ͘ϱϯϯϲϳ Ϭ ϲ͘ϬϴϬϲϮϭ Ϭ͘ϬϮϮϱϬϵ Ϭ Ϭ͘ϬϬϬϱϰϰ^ĂŶDĂƚĞŽ ϮϬϮϮ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϮϴϵ͘ϵϭϳ ϭϭϴϳϱϴ͘ϱ ϭϭϴϳϱϴ͘ϱ Ϭ ϭϯϴϴϲ͘ϱϵ ϯ͘ϯϲϳϰϲϳ ϱϬ͘ϭϯϵϬϴ Ϯ͘ϱϲϳϴϬϱ Ϭ͘ϬϮϲϲϵϳ Ϭ͘ϬϰϭϬϱϰ Ϭ Ϭ͘ϬϬϴϲϭ Ϭ͘Ϭϯϭϱϭϱ Ϭ͘ϬϮϳϵϬϰ Ϭ͘ϬϰϮϵϭ Ϭ Ϭ͘Ϭϯϰϰϰ Ϭ͘ϬϵϬϬϰϮ ϭϴϲϴ͘ϳ ϴϱϮϮ͘ϲϭϵ Ϭ Ϭ͘ϬϬϭϵϰϮ Ϭ͘ϭϱϱϭϬϰ Ϭ Ϭ͘Ϯϵϰϰϭϰ ϭ͘ϯϰϮϳϰϮ Ϭ Ϭ͘ϬϰϭϴϮϭ ϯ͘ϯϯϵϯϱϱϬϬϬϬϬ͘Ϭϰϳϲϭ ϯ͘ϴϬϭϲϬϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϴϲϳϴϵ Ϭ͘ϭϱϵϬϬϱ ϰϯ͘ϴϮϮϳϲ Ϭ Ϭ͘Ϭϭϳϲϵϱ Ϭ͘ϬϴϬϳϬϰ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϰϰ͘ϭϲϭϮ ϵϳϲϴ͘ϲϯϴ ϵϳϲϴ͘ϲϯϴ Ϭ ϵϱϬ͘ϳϱϮϰ ϭ͘ϴϰϱϭϯϵ ϭϬ͘ϯϬϰϮϵ Ϭ Ϭ͘ϬϬϮϬϱϭ Ϭ͘ϬϭϭϮϭϳ Ϭ Ϭ͘ϬϬϵ Ϭ͘Ϭϱϴϵϰϯ Ϭ͘ϬϬϮϮϯ Ϭ͘ϬϭϮϭϵϵ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϭϲϴϰϬϴ ϭϱϱϳ͘ϳϱϭ ϴϯϳϬ͘ϬϬϲ Ϭ ϯ͘ϲϲϲϯϴϯ Ϯϱ͘ϲϬϴϰϭ Ϭ Ϭ͘ϯϭϳϱϱϴ ϭ͘ϳϬϲϮϴϭ Ϭ Ϭ͘ϬϴϳϮϰϵ Ϭ͘ϰϮϵϯϵϯϬϬϬϬϯ͘ϳϴϭϱϯϰ Ϯϲ͘ϮϬϳϲϬϬϬϬϬ͘ϳϯϰϭϮϯ ϭϴ͘ϯϱϯϬϭ ϲϳ͘ϱϴϮϰϲ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϮϰϬϲϲϲ͘ϰ ϳϵϵϱϱϲϱ ϳϵϵϱϱϲϱ Ϭ ϭϭϯϬϵϵϳ Ϭ͘ϬϰϳϳϬϮ Ϭ Ϭ͘ϮϳϱϮϴϮ Ϭ͘ϬϬϭϮϰϭ Ϭ Ϭ͘ϬϬϮϭϬϱ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϰϳ Ϭ͘ϬϬϭϯϱϬ Ϭ͘ϬϬϮϮϴϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϳϬϳ ϮϴϮ͘ϬϬϳϮ Ϭ ϳϮ͘Ϭϴϳϵϲ Ϭ͘ϬϬϮϱϰϲ Ϭ Ϭ͘Ϭϳϳϯϲϳ Ϭ͘ϬϬϰϴϲϵ Ϭ Ϭ͘Ϭϯϯϰϴϲ Ϭ͘ϬϭϬϭϰϮ Ϭ Ϭ͘ϯϲϴϬϬϰ Ϭ͘ϬϵϬϮϱϳ Ϭ͘ϮϯϬϮϲ ϭ͘ϯϲϱϮϳϵ Ϭ͘Ϭϭϰϳϵϳ Ϭ Ϭ͘ϰϬϮϵϭϲ Ϭ͘ϬϵϬϮϱϳ Ϭ͘ϮϯϬϮϲ ϭ͘ϯϲϱϮϳϵ Ϭ͘ϬϯϰϱϴϮ Ϭ͘ϳϮϲϬϲϱ Ϭ ϯ͘ϲϭϳϲϬϮ Ϭ͘ϬϬϮϳϴϴ Ϭ Ϭ͘ϬϬϬϳϭϯ^ĂŶDĂƚĞŽ ϮϬϮϮ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϴϴϴ͘ϱϯϵϱ ϮϮϱϬϭ͘ϴϴ ϮϮϱϬϭ͘ϴϴ Ϭ ϯϳϵϬ͘ϳϴϲ Ϭ͘ϮϰϬϬϭϮ Ϭ Ϭ Ϭ͘Ϭϭϱϴϴϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϵϭ Ϭ͘Ϭϭϲϱϵϵ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϴϯϭ Ϯϯϲ͘ϱϯϱϰ Ϭ Ϭ Ϭ͘ϬϬϭϮϲϳ Ϭ Ϭ Ϭ͘ϬϯϳϮϲϲ Ϭ Ϭ Ϭ͘ϬϮϳϮϳϬϬϬϬϬϬ͘ϬϯϭϬϰϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϯϯϬϬϬϰ Ϭ Ϭ Ϭ͘ϬϬϮϮϰϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϰϱϵϭ͘ϰ ϱϲϴϮϱϴ͘ϳ Ϭ ϱϲϴϮϱϴ͘ϳ ϳϮϵϵϲ͘ϲϲϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϵ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϲϴϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϮ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϲϮϳϭ͘ϳϱϴ Ϯϰϵϯϴϭ͘ϵ ϭϮϳϱϲϮ͘ϰ ϭϮϭϴϭϵ͘ϱ Ϯϱϵϯϯ͘ϳϮ Ϭ͘ϬϬϯϮϴϲ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϲϲϯ Ϭ Ϭ͘ϬϬϮϭϲϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϭϭ Ϭ͘ϬϬϬϳϮϮ Ϭ Ϭ͘ϬϬϮϯϱϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϰϳ ϭϯϴ͘ϬϱϮϴ Ϭϲϲ͘Ϯϳϭϭϱ Ϭ͘ϬϬϬϰϯ Ϭ Ϭ͘ϬϰϮϴϬϲ Ϭ͘ϬϬϬϱϴ Ϭ Ϭ͘ϬϮϬϲϳϭ Ϭ͘ϬϬϭϯϴϭ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϯϲϭϰϮ Ϭ͘ϬϯϮϯϬϮ Ϭ͘ϯϵϳϮϲ Ϭ͘ϬϬϮϬϭϱ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϯϲϭϰϮ Ϭ͘ϬϯϮϯϬϮ Ϭ͘ϯϵϳϮϲ Ϭ͘ϬϮϬϬϭϯ Ϭ͘ϮϬϲϮϮϵ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϯϲϱ Ϭ Ϭ͘ϬϬϬϲϱϱ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϰϭϯϲ͘ϰϳ ϳϯϲϭϵϲ͘ϭ ϳϯϲϭϵϲ͘ϭ Ϭ ϭϬϵϱϳϭ Ϭ͘ϭϯϰϵϭϵ Ϭ Ϭ͘ϯϵϱϬϳϰ Ϭ͘ϬϬϭϳϵϭ Ϭ Ϭ͘ϬϬϮϳϵϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϯϴ Ϭ͘ϬϬϭϵϰϴ Ϭ Ϭ͘ϬϬϯϬϰϯ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϭϬϳ ϯϯϭ͘ϭϴϴϭ Ϭ ϴϳ͘ϵϬϰϮϭ Ϭ͘ϬϬϲϯϭ Ϭ Ϭ͘ϭϬϵϮϭϴ Ϭ͘ϬϬϵϱϰϯ Ϭ Ϭ͘Ϭϯϴϳϰϱ Ϭ͘ϬϮϴϰϭϱ Ϭ Ϭ͘ϱϲϵϳϴϮ Ϭ͘ϭϱϳϱϮϮ Ϭ͘ϰϱϲϬϲϵ Ϯ͘ϰϲϳϵϬϭ Ϭ͘Ϭϰϭϰϯϲ Ϭ Ϭ͘ϲϮϯϴϯϲ Ϭ͘ϭϱϳϱϮϮ Ϭ͘ϰϱϲϬϲϵ Ϯ͘ϰϲϳϵϬϭ Ϭ͘Ϭϯϲϰϵϵ ϭ͘ϯϲϴϵϭϲ Ϭ ϱ͘ϲϮϰϰϰϴ Ϭ͘ϬϬϯϮϳϰ Ϭ Ϭ͘ϬϬϬϴϲϵ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϴ͘ϱϭϬϵϭϲ ϭϭϵ͘ϰϵϴϮ ϭϭϵ͘ϰϵϴϮ Ϭ Ϯϱ͘ϭϭϰϱϱ ϭ͘ϲϵϬϮϲϵ Ϭ Ϭ Ϭ͘Ϯϰϭϰϲϰ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϯϯϰ Ϭ͘ϮϱϮϯϴϮ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϱϰϯ ϰϭϴ͘ϰϯϲϯ Ϭ Ϭ Ϭ͘Ϭϭϰϴϴϲ Ϭ Ϭ Ϭ͘ϬϲϱϵϮϱ Ϭ Ϭ Ϭ͘ϯϮϬϰϴϴϬϬϬϬϬϬ͘ϯϲϰϴϱϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ ϭ͘ϳϬϵϱϲϮ Ϭ Ϭ Ϭ͘ϬϬϯϵϲϱ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϲϭ͘ϵϯϴϵϯ ϮϬϱϰ͘ϵ Ϭ ϮϬϱϰ͘ϵ Ϯϵϰ͘ϭϴϳϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϴ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϵϰϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϭϵ͘ϰϬϲϵϮ ϴϰϵ͘ϭϯϯϵ ϰϬϲ͘Ϯϳϰϰ ϰϰϮ͘ϴϱϵϰ ϴϬ͘Ϯϰϳϲϭ Ϭ͘ϬϬϯϬϳϰ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϭϯ Ϭ Ϭ͘ϬϬϭϰϱϲ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϮϮ Ϭ͘ϬϬϬϰϰϵ Ϭ Ϭ͘ϬϬϭϱϴϯ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϳϳ ϭϮϵ͘ϭϱϯϭ ϬϳϮ͘ϰϴϱϵ Ϭ͘ϬϬϬϰϬϰ Ϭ Ϭ͘ϬϰϮϵϲϳ Ϭ͘ϬϬϬϱϰϲ Ϭ Ϭ͘ϬϮϬϴϮ Ϭ͘ϬϬϭϮϵϮ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϰϵϬϱ Ϭ͘ϬϮϮϴϵϮ Ϭ͘Ϯϴϳϳϰϴ Ϭ͘ϬϬϭϴϴϱ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϰϵϬϱ Ϭ͘ϬϮϮϴϵϮ Ϭ͘Ϯϴϳϳϰϴ Ϭ͘ϬϮϬϬϵϱ Ϭ͘ϭϵϯϬϭϭ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϳϳ Ϭ Ϭ͘ϬϬϬϳϭϳ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϮϴϳϳϱ͘ϴ ϰϰϴϵϮϬϴ ϰϰϴϵϮϬϴ Ϭ ϲϭϳϮϱϴ͘ϱ Ϭ͘ϬϲϮϱϳϱ Ϭ Ϭ͘ϯϮϰϲϱϵ Ϭ͘ϬϬϭϮϳϮ Ϭ Ϭ͘ϬϬϮϬϯϯ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϭϲ Ϭ͘ϬϬϭϯϴϰ Ϭ Ϭ͘ϬϬϮϮϭϮ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϳϲϭ ϯϰϯ͘ϳϵϭϱ Ϭ ϴϳ͘ϴϱϵϲϮ Ϭ͘ϬϬϮϲϯϵ Ϭ Ϭ͘ϬϴϭϰϮϵ Ϭ͘ϬϬϱϰϮϴ Ϭ Ϭ͘Ϭϯϲϰϳϲ Ϭ͘ϬϭϬϯϯϱ Ϭ Ϭ͘ϯϳϴϭϬϲ Ϭ͘ϬϲϴϭϮϭ Ϭ͘ϭϳϮϮϬϱ ϭ͘ϬϳϮϳϵ Ϭ͘ϬϭϱϬϳϴ Ϭ Ϭ͘ϰϭϯϵϳϴ Ϭ͘ϬϲϴϭϮϭ Ϭ͘ϭϳϮϮϬϱ ϭ͘ϬϳϮϳϵ Ϭ͘Ϭϯϲϴϲ Ϭ͘ϳϰϴϭϭϵ Ϭ ϯ͘ϳϮϱϰϱϭ Ϭ͘ϬϬϯϯϵϵ ϬϬ͘ϬϬϬϴϲϵ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϵϴ͘ϵϭϳϵ ϭϳϰϱϱ͘ϭ ϭϳϰϱϱ͘ϭϬ ϮϰϬϲ͘ϭϭϭ Ϭ͘ϬϰϳϳϮϲ Ϭ Ϭ Ϭ͘ϬϬϱϭϰϳ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϯϴ Ϭ͘ϬϬϱϯϴ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϮϮ ϯϭϳ͘ϲϬϲϱ Ϭ Ϭ Ϭ͘ϬϬϬϲϮϰ Ϭ Ϭ Ϭ͘ϬϱϬϬϯϵ Ϭ Ϭ Ϭ͘ϬϭϯϰϯϲϬϬϬϬϬϬ͘ϬϭϱϮϵϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϮϰϱϭϱ Ϭ Ϭ Ϭ͘ϬϬϯϬϬϵ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϱϬϮ͘ϲϵϭ ϭϲϱϯϲ͘ϯϱ Ϭ ϭϲϱϯϲ͘ϯϱ Ϯϱϵϭ͘ϯϯϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϯ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϱϯϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϮ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϵϯϴ͘ϱϯϱϮ ϯϵϳϴϬ͘ϭϯ ϭϵϲϰϳ͘Ϯϱ ϮϬϭϯϮ͘ϴϴ ϯϴϴϬ͘ϴϰϯ Ϭ͘ϬϬϯϭϳϯ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϱϯϯ Ϭ Ϭ͘ϬϬϭϴϮϰ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϭϲ Ϭ͘ϬϬϬϱϴ Ϭ Ϭ͘ϬϬϭϵϴϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϲϭ ϭϯϯ͘ϯϭϰϮ Ϭ ϳϴ͘ϯϰϬϳϳ Ϭ͘ϬϬϬϰϭϳ Ϭ Ϭ͘ϬϰϮϵϲϳ Ϭ͘ϬϬϬϱϲϰ Ϭ Ϭ͘ϬϮϬϴϮ Ϭ͘ϬϬϭϯϯϰ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϲϮϯϳ Ϭ͘ϬϮϰϳϲϮ Ϭ͘ϯϭϮϵϬϭ Ϭ͘ϬϬϭϵϰϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϲϮϯϳ Ϭ͘ϬϮϰϳϲϮ Ϭ͘ϯϭϮϵϬϭ Ϭ͘ϬϮϬϳϭϮ Ϭ͘ϭϵϵϮϬϴ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϯϭϴ Ϭ Ϭ͘ϬϬϬϳϳϰ^ĂŶDĂƚĞŽ ϮϬϮϮ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϬϬϬϯ͘ϲϰ ϯϳϵϱϮϭ͘ϱ ϯϳϵϱϮϭ͘ϱ Ϭ ϭϰϵϬϯϵ͘ϯ Ϭ͘ϭϰϳϴϱϱ Ϭ͘ϬϯϲϲϮϱ Ϭ͘ϲϮϳϵϵϴ Ϭ͘ϬϬϭϰϳϱ Ϭ Ϭ͘ϬϬϬϮϴ Ϭ͘ϬϬϮ Ϭ͘ϬϮϳϯ Ϭ͘ϬϬϭϲϬϰ Ϭ Ϭ͘ϬϬϬϯϬϰ Ϭ͘ϬϬϴ Ϭ͘Ϭϳϴ ϴϳϯ͘ϵϵϲϭ ϭϭϵ͘ϯϯϭϴ Ϯϳ͘ϮϭϬϰ Ϭ͘ϬϬϳϯϰ Ϭ͘ϭϭϱϮϲϲ Ϭ͘ϬϯϮϰ Ϭ͘ϬϬϴϯϴϴ Ϭ͘ϬϬϯϬϳϴ Ϭ͘Ϭϱϭϴϯϱ Ϭ͘Ϭϯϲϭϯϭ Ϭ͘ϰϭϵϳϱϵ Ϭ͘ϭϱϵϬϴϭ Ϭ͘Ϭϯϵϴϳϲ Ϭ͘ϮϭϮϰϳ Ϯ͘ϭϰϯϮϬϱ Ϭ͘ϬϱϮϳϮϮ Ϭ͘ϲϭϮϱϭϮ Ϭ͘ϭϳϰϭϳϰ Ϭ͘Ϭϯϵϴϳϲ Ϭ͘ϮϭϮϰϳ Ϯ͘ϭϰϯϮϬϱ Ϭ͘ϬϰϰϵϮϮ ϭ͘ϬϲϬϳϬϳ ϯ͘ϳϱϴϱϬϯ ϯ͘ϮϴϬϮ Ϭ͘ϬϬϴϲϰ Ϭ͘ϬϬϭϭϴ Ϭ͘ϬϬϬϮϲϵ^ĂŶDĂƚĞŽ ϮϬϮϮ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϭϮϱ͘ϵϭϭ ϭϲϯϲϱϲ͘ϵ ϭϲϯϲϱϲ͘ϵ Ϭ ϱϭϴϵϴ͘ϳϳ ϭ͘ϱϬϰϮϭϯ ϭ͘ϵϯϭϴϯϭ Ϭ Ϭ͘ϬϯϭϱϭϮ Ϭ͘ϬϮϳϭϱϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϮϳϯ Ϭ͘ϬϯϮϵϯϳ Ϭ͘ϬϮϴϯϴϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϳϴ ϲϯϳ͘ϴϮϭϱ ϭϯϭ͘ϳϱϭϱ Ϭ Ϭ͘ϬϬϳϰϴϱ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϬϬϰϴϵϬ͘ϬϮϬϳϱϳ Ϭ Ϭ͘ϭϲϭϭϰϭ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϴϯϰϰϴ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϳϱϰϬϭ Ϭ͘ϰϯϭϮϵϴ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϲϬϰϰ Ϭ͘ϬϬϭϮϰϴ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϭϲϲ͘ϴϰϴ ϰϭϵϮϴ͘ϲϵ ϰϭϵϮϴ͘ϲϵ Ϭ ϭϳϯϴϰ͘ϯ Ϭ͘ϭϳϮϰϰϰ Ϭ͘Ϭϯϲϯϯϱ Ϭ͘ϲϯϴϳϵ Ϭ͘ϬϬϭϰϯϴ Ϭ Ϭ͘ϬϬϬϮϱϲ Ϭ͘ϬϬϮ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϬϭϱϲϯ Ϭ Ϭ͘ϬϬϬϮϳϵ Ϭ͘ϬϬϴ Ϭ͘Ϭϵϭ ϵϴϳ͘ϰϵϱϮ ϭϯϴ͘ϰϳϵϯ Ϯϱ͘ϴϴϵϵϳ Ϭ͘ϬϬϲϵϭϳ Ϭ͘ϭϭϯϮϰϲ Ϭ͘ϬϯϮϱϮϰ Ϭ͘ϬϭϬϬϯϵ Ϭ͘ϬϬϮϵϯϴ Ϭ͘ϬϱϬϱϲϳ Ϭ͘ϬϯϮϱϱϰ Ϭ͘ϰϭϲϰϯϱ Ϭ͘ϭϲϭϭϱϰ Ϭ͘ϬϰϮϰϱϭ Ϭ͘ϮϮϯϲϱϭ Ϯ͘ϮϱϲϵϭϮ Ϭ͘ϬϰϳϱϬϯ Ϭ͘ϲϬϳϲϲ Ϭ͘ϭϳϲϰϰϰ Ϭ͘ϬϰϮϰϱϭ Ϭ͘ϮϮϯϲϱϭ Ϯ͘ϮϱϲϵϭϮ Ϭ͘Ϭϰϰϵϴϰ Ϭ͘ϵϲϵϬϵ ϯ͘ϳϱϴϭϲϮ ϯ͘ϮϳϮϭϭ Ϭ͘ϬϬϵϳϲϮ Ϭ͘ϬϬϭϯϲϵ Ϭ͘ϬϬϬϮϱϲ^ĂŶDĂƚĞŽ ϮϬϮϮ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϳϭϴ͘ϯϲϱ ϳϬϬϳϳ͘ϳϳ ϳϬϬϳϳ͘ϳϳ Ϭ Ϯϭϲϭϰ͘ϴϳ ϭ͘Ϭϲϯϯϲϰ ϭ͘ϴϰϱϯϯϵ Ϭ Ϭ͘ϬϮϲϰϱϭ Ϭ͘ϬϮϲϵϲϮ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϮϳϲϰϳ Ϭ͘ϬϮϴϭϴϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϵϭ ϳϲϬ͘ϰϯϲϵ ϮϬϵ͘Ϭϯϭϳ Ϭ Ϭ͘ϬϬϲϲ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϭϵϴϬϳ Ϭ͘ϬϯϮϵϯϯ Ϭ Ϭ͘ϭϰϮϬϵϭ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϲϭϳϲϭ Ϭ͘ϭϮϰϵϱϰϬϬϬϬϬ͘ϭϵϬϮϮϮ Ϭ͘ϯϯϵϴϯ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϳϮϬϲ Ϭ͘ϬϬϭϵϴϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ Dz ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϭϳϳϱ͘ϭϭ ϳϬϬϮϵ͘ϲϮ ϳϬϬϮϵ͘ϲϮ Ϭ ϮϯϱϱϬ͘ϮϮ Ϭ͘ϱϲϯϯϳϲ Ϭ Ϭ͘ϭϰϴϭϰϱ Ϭ͘ϬϬϭϴϴ Ϭ Ϭ͘ϬϬϯϴϯϲ Ϭ͘ϬϬϭ Ϭ͘ϬϬϰϮ Ϭ͘ϬϬϮϬϬϳ Ϭ Ϭ͘ϬϬϰϬϳ Ϭ͘ϬϬϰ Ϭ͘ϬϭϮ ϭϴϴ͘ϲϵϮ Ϭ ϱϬ͘ϬϳϭϬϮ Ϭ͘ϭϱϵϰϰϵ Ϭ Ϭ͘ϭϵϭϯϴϵ Ϭ͘Ϭϯϴϴϱϵ Ϭ Ϭ͘ϬϬϴϲϳϭ ϭ͘ϬϱϰϵϮϮ Ϭ ϭ͘ϰϯϮϲϳ ϯ͘ϱϱϵϬϯϵ ϯ͘ϳϮϮϯϳϭ ϯ͘ϱϵϭϮϲϳ ϭ͘ϮϱϵϴϮϭ Ϭ ϭ͘ϱϱϳϭϱϲϯ͘ϱϱϵϬϯϵ ϯ͘ϳϮϮϯϳϭ ϯ͘ϱϵϭϮϲϳ Ϭ͘ϬϬϴϳϲϳ ϭϮ͘ϯϯϬϭϱ Ϭ ϳ͘ϵϲϯϯϳϳ Ϭ͘ϬϬϭϴϲϱ Ϭ Ϭ͘ϬϬϬϰϵϱ^ĂŶDĂƚĞŽ ϮϬϮϮ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϮϯϵϵ͘ϱϰ ϮϱϲϭϱϯϮ ϮϱϲϭϱϯϮ Ϭ ϯϰϰϵϲϵ͘ϵ Ϭ͘ϬϴϮϮϴϰ Ϭ Ϭ͘ϰϬϱϳϯϲ Ϭ͘ϬϬϭϯϬϮ Ϭ Ϭ͘ϬϬϮϮϬϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϯϲ Ϭ͘ϬϬϭϰϭϲ Ϭ Ϭ͘ϬϬϮϯϵϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϭϳ ϰϭϰ͘Ϭϴϲ Ϭ ϭϬϲ͘ϰϭϲϱ Ϭ͘ϬϬϯϮϴϱ Ϭ Ϭ͘Ϭϵϳϵϰϰ Ϭ͘ϬϬϲϰϮϭ Ϭ Ϭ͘Ϭϯϵϲϵ Ϭ͘ϬϭϯϳϬϴ Ϭ Ϭ͘ϰϴϵϴϵϵ Ϭ͘Ϭϳϴϭϳϱ Ϭ͘ϮϬϴϲϳϲ ϭ͘Ϯϲϰϰϭϯ Ϭ͘Ϭϭϵϵϳϳ Ϭ Ϭ͘ϱϯϲϯϳϯ Ϭ͘Ϭϳϴϭϳϱ Ϭ͘ϮϬϴϲϳϲ ϭ͘Ϯϲϰϰϭϯ Ϭ͘ϬϯϳϮϳϵ Ϭ͘ϴϮϮϮϱϵ Ϭ ϰ͘Ϭϱϳϵϲϭ Ϭ͘ϬϬϰϬϵϰ ϬϬ͘ϬϬϭϬϱϮ^ĂŶDĂƚĞŽ ϮϬϮϮ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϬϰϴ͘ϭϰϰ ϯϳϰϳϵ͘ϰϲ ϯϳϰϳϵ͘ϰϲ Ϭ ϱϬϯϲ͘ϴϵϲ Ϭ͘Ϭϰϳϱϯϴ Ϭ Ϭ Ϭ͘ϬϬϰϳϳϳ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϳϳ Ϭ͘ϬϬϰϵϵϯ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϵϯϰ ϰϭϯ͘ϴϱϰϯ Ϭ Ϭ Ϭ͘ϬϬϬϰϴϲ Ϭ Ϭ Ϭ͘ϬϲϱϮϬϯ Ϭ Ϭ Ϭ͘ϬϭϬϰϱϲϬϬϬϬϬϬ͘ϬϭϭϵϬϰ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϴϬϵϵϴ Ϭ Ϭ Ϭ͘ϬϬϯϵϮϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϰϵϳ͘ϲϮϳϰ ϭϲϯϳϱ͘ϰϭ Ϭ ϭϲϯϳϱ͘ϰϭ Ϯϱϲϱ͘ϱϵϴ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϮϯ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϱϭϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϮ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϱϭϳ͘ϴϱϯϳ Ϯϭϵϲϲ͘Ϭϴ ϭϭϭϬϲ͘ϭϮ ϭϬϴϱϵ͘ϵϲ Ϯϭϰϭ͘ϯϮϱ Ϭ͘ϬϬϯϮϰϴ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϲϲϮ Ϭ Ϭ͘ϬϬϮϮϭϲ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϭϯ Ϭ͘ϬϬϬϳϮ Ϭ Ϭ͘ϬϬϮϰϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϱϮ ϭϯϲ͘ϰϲϱϯ Ϭ ϵϳ͘ϴϭϬϰϵ Ϭ͘ϬϬϬϰϮϴ Ϭ Ϭ͘ϬϰϯϬϵϰ Ϭ͘ϬϬϬϱϴϭ Ϭ Ϭ͘ϬϮϬϵϯϴ Ϭ͘ϬϬϭϯϲϱ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϴϲϱϴ Ϭ͘ϬϮϳϴϲϴ Ϭ͘ϯϰϰϴϰϭ Ϭ͘ϬϬϭϵϵϮ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϴϲϱϴ Ϭ͘ϬϮϳϴϲϴ Ϭ͘ϯϰϰϴϰϭ Ϭ͘ϬϮϭϮϯϱ Ϭ͘ϮϬϯϴϴϱ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϯϰϵ Ϭ Ϭ͘ϬϬϬϵϲϳ^ĂŶDĂƚĞŽ ϮϬϮϮ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϱϭ͘ϲϰϴϴ ϳϬϰϯ͘ϵϮϲ ϳϬϰϯ͘ϵϮϲ Ϭ ϳϱ͘ϭϵϰϵϰ Ϭ͘ϰϲϱϱϱϮ Ϭ Ϭ͘ϰϬϯϳϳϵ Ϭ͘ϬϬϭϴϲϯ Ϭ Ϭ͘ϬϬϬϰϳ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϮϬϮϲ Ϭ Ϭ͘ϬϬϬϱϭϮ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϵϰϴ͘ϭϳϰ Ϭ ϯϮ͘Ϯϰϱϭϴ Ϭ͘ϬϭϳϵϮϭ Ϭ Ϭ͘ϬϯϵϬϰϴ Ϭ͘ϬϮϳϰϳϳ Ϭ Ϭ͘ϬϰϭϮϭϵ Ϭ͘ϬϴϬϳϰϴ Ϭ Ϭ͘ϭϳϬϲϰ ϭϮ͘ϳϬϵϮϳ Ϭ͘Ϯϵϲϵϴϵ ϰ͘ϯϯϵϭϯϰ Ϭ͘ϭϭϳϴϮϴ Ϭ Ϭ͘ϭϴϲϴϮϵ ϭϮ͘ϳϬϵϮϳ Ϭ͘Ϯϵϲϵϴϵ ϰ͘ϯϯϵϭϯϰ Ϭ͘Ϭϰϰϳϰϰ Ϯ͘ϬϳϮϵϰϲ Ϭ ϯ͘ϴϰϳϲϮϰ Ϭ͘ϬϭϵϮϲ ϬϬ͘ϬϬϬϯϭϵ^ĂŶDĂƚĞŽ ϮϬϮϮ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϯϬϬ͘ϯϴϵϰ ϯϮϱϬ͘ϲϴϵ ϯϮϱϬ͘ϲϴϵϬ ϯϬ͘Ϭϯϴϵϰ ϯ͘ϰϬϭϵϵϲ Ϭ Ϭ Ϭ͘ϬϲϯϬϭϵ Ϭ Ϭ Ϭ͘ϬϬϰ Ϭ͘Ϭϭϱϲϳϱ Ϭ͘Ϭϲϱϴϲϴ Ϭ Ϭ Ϭ͘Ϭϭϲ Ϭ͘Ϭϰϰϳϴϱ ϭϬϴϰ͘ϳϲϳ Ϭ Ϭ Ϭ͘ϬϬϰϱϴ Ϭ Ϭ Ϭ͘ϭϳϬϵϬϲ Ϭ Ϭ Ϭ͘ϬϵϴϲϭϬϬϬϬϬϬ͘ϭϭϮϮϲϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϳϵϲϳϲ Ϭ͘ϯϭϱϱϵϮ Ϭ Ϭ Ϭ͘ϬϭϬϮϳϵ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϱϲ͘ϱϰϬϭ ϰϰϰϴϯ͘ϳ ϰϰϰϴϯ͘ϳ Ϭ ϭϱϭϯϲ͘ϴϱ Ϭ͘ϲϬϰϬϵϰ Ϭ͘ϬϴϴϮϰϱ Ϭ͘ϰϲϱϴϭ Ϭ͘ϬϬϭϰϭ Ϭ Ϭ͘ϬϬϬϱϳϱ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϱϲϬ͘ϬϬϭϱϯϰ Ϭ Ϭ͘ϬϬϬϲϮϱ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϳϵϱ͘ϰϲϮ ϱϯϳ͘ϰϰϭϮ ϰϳ͘ϲϰϰϮϮ Ϭ͘Ϭϭϵϲϲϯ Ϭ͘Ϯϱϲϵϵϲ Ϭ͘Ϭϱϭϯϱϰ Ϭ͘ϬϮϴϮϯϱ Ϭ͘ϬϬϳϭϬϲ Ϭ͘ϬϯϰϬϮϵ Ϭ͘ϬϵϴϯϳϮ ϭ͘ϬϬϵϭϭϲ Ϭ͘ϮϴϴϬϴϭϬ͘Ϭϯϴϭϱϭ Ϭ͘ϯϭϰϬϵϱ Ϯ͘ϵϯϳϵϴϭ Ϭ͘ϭϰϯϱϰϱ ϭ͘ϰϳϮϱ Ϭ͘ϯϭϱϰϭϯ Ϭ͘Ϭϯϴϭϱϭ Ϭ͘ϯϭϰϬϵϱ Ϯ͘ϵϯϳϵϴϭ Ϭ͘Ϭϰϰϵϱϰ Ϯ͘ϬϴϬϬϲϲ ϭϱ͘Ϭϳϰϳϭ ϲ͘ϯϵϲϯϰϭ Ϭ͘Ϭϭϳϳϱ Ϭ͘ϬϬϱϯϭϯ Ϭ͘ϬϬϬϰϳϭ^ĂŶDĂƚĞŽ ϮϬϮϮ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϭϱϲ͘Ϭϱϭ ϭϳϰϯϬϰ ϭϳϰϯϬϰ Ϭ ϰϵϵϵϱ͘ϲϵ ϭ͘ϴϱϯϯϯϰ ϭϱ͘ϴϵϳϬϭ ϭ͘ϰϯϲϭϭϳ Ϭ͘ϬϮϯϭϴϮ Ϭ͘Ϭϰϳϵϴϴ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϵϴϯ Ϭ͘ϬϮϰϮϯ Ϭ͘ϬϱϬϭϱϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϲϲϲ ϭϭϲϯ͘ϳϳϱ ϮϯϮϳ͘ϳϱϮ Ϭ Ϭ͘ϬϬϮϴϭϯ Ϭ͘Ϭϭϯϵϵϵ Ϭ Ϭ͘ϭϴϯϯϱϯ Ϭ͘ϯϲϲϳϯϴ Ϭ Ϭ͘ϬϲϬϱϱϲ Ϭ͘ϯϬϭϰϬϰϬϬϬϬϬ͘Ϭϲϴϵϯϵ Ϭ͘ϯϰϯϭϮϲ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϵϯϲϬϱ Ϭ͘ϭϵϬϯϴϯ ϳ͘ϮϲϱϯϬϰ Ϭ Ϭ͘ϬϭϭϬϮ Ϭ͘ϬϮϮϬϰϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϰϬ͘ϲϯϮϰ ϭϴϳϯ͘Ϯϱϳ ϭϴϳϯ͘Ϯϱϳ Ϭ ϯϴϭ͘ϳϱϮϭ Ϭ͘ϭϱϯϴϱϭ ϲ͘ϱϭϰϯϮϴ Ϭ Ϭ͘ϬϬϭϭϬϰ Ϭ͘Ϭϭϲϵϱϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϲϬϳϲ Ϭ͘ϬϬϭϮϬϭ Ϭ͘ϬϭϴϰϰϮ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϵϯϮ ϭϬϭϲ͘ϳϬϴ ϱϯϮϯ͘Ϭϭϲ Ϭ Ϭ͘ϳϰϳϭϰϰ ϭϳ͘ϳϵϰϰϱ Ϭ Ϭ͘ϮϬϳϮϲϯ ϭ͘ϬϴϱϭϯϮ Ϭ Ϭ͘ϬϭϬϲϳϱ Ϭ͘ϮϱϰϮϰϴϬϬϬϬϬ͘ϳϲϮϱϭϱ ϭϴ͘ϭϲϬϱϱϬϬϬϬϭ͘Ϭϲϯ͘ϬϰϲϮϵϮ ϯϮ͘ϭϮϭϴϰϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϮ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϱϲ͘ϭϵϮϰ ϭϱϴϲϵ͘Ϭϰ ϭϱϴϲϵ͘Ϭϰ Ϭ ϱϭϮϱ͘ϴϵϴ Ϭ͘ϯϯϰϰϱϭ Ϭ͘ϬϲϱϬϰϵ Ϭ͘ϯϳϮϵϳϰ Ϭ͘ϬϬϬϵϲϳ Ϭ Ϭ͘ϬϬϬϮϴϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϲϴ Ϭ͘ϬϬϭϬϱϮ Ϭ Ϭ͘ϬϬϬϯϬϲ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϳϵϵ ϭϳϲϮ͘ϲϴϴ ϯϳϲ͘ϱϳϰϮ ϯϬ͘ϱϳϱϮ Ϭ͘ϬϭϬϯϵϰ Ϭ͘ϮϬϱϵϳ Ϭ͘Ϭϯϯϳϳϲ Ϭ͘Ϭϭϴϰϰ Ϭ͘ϬϬϱϴϵϵ Ϭ͘ϬϯϮϭϳϵ Ϭ͘ϬϰϵϮϰϴ Ϭ͘ϳϰϲϬϳϲ Ϭ͘ϭϲϲϴϯϮϬ͘ϬϮϲϱϱ Ϭ͘ϭϭϭϴϭϭ ϭ͘ϴϳϱϭϳϮ Ϭ͘ϬϳϭϴϲϮ ϭ͘ϬϴϴϲϳϮ Ϭ͘ϭϴϮϲϲ Ϭ͘ϬϮϲϱϱ Ϭ͘ϭϭϭϴϭϭ ϭ͘ϴϳϱϭϳϮ Ϭ͘Ϭϰϰϵϭϳ ϭ͘Ϭϳϵϵϲϴ ϱ͘ϳϳϯϰϳϵ ϯ͘ϱϭϳϱϴϯ Ϭ͘ϬϭϳϰϮϲ Ϭ͘ϬϬϯϳϮϯ Ϭ͘ϬϬϬϯϬϮ^ĂŶDĂƚĞŽ ϮϬϮϮ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϬϮϰ͘ϭϴ ϳϰϮϮϭ͘ϲϳ ϳϰϮϮϭ͘ϲϳ Ϭ ϭϬϬϯϱ͘ϭϵ ϭ͘ϬϳϮϳϬϯ ϲ͘ϯϰϮϱϵϭ ϭ͘ϰϮϵϲϲϵ Ϭ͘ϬϭϬϱϵϮ Ϭ͘ϬϬϯϲϱ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϳϰϮ Ϭ͘ϬϭϭϬϳϭ Ϭ͘ϬϬϯϴϭϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϵϳϳ ϭϮϱϳ͘ϯϲϱ ϭϮϲϲ͘ϲϲϴ Ϭ Ϭ͘ϬϬϭϰϬϱ Ϭ͘ϬϭϰϮϵϮ Ϭ Ϭ͘ϭϵϴϬϵϴ Ϭ͘ϭϵϵϱϲϰ Ϭ Ϭ͘ϬϯϬϮϰϰ Ϭ͘ϯϬϳϲϵϴϬϬϬϬϬ͘Ϭϯϰϰϯ Ϭ͘ϯϱϬϮϵϭϬϬϬϬϬ͘ϮϭϬϭϯϰ Ϭ͘ϭϭϲϲϱϱ ϱ͘ϰϭϯϮϲϭ Ϭ Ϭ͘ϬϭϭϵϬϲ Ϭ͘Ϭϭϭϵϵϱ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϭ͘ϵϲϴϴϳ ϲϱϰ͘ϯϳϭϯ ϲϱϰ͘ϯϳϭϯ Ϭ ϭϬϲ͘ϱϮϮϵ Ϭ͘Ϯϵϯϳϭϵ ϭ͘ϱϴϭϬϱ Ϭ Ϭ͘ϬϬϬϱϲϲ Ϭ͘ϬϬϮϴϱϴ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϲϭϰϴ Ϭ͘ϬϬϬϲϭϱ Ϭ͘ϬϬϯϭϬϵ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϲϭϯϳ ϭϬϲϵ͘ϴϭϮ ϭϮϬϮ͘ϭϴϰ Ϭ Ϭ͘ϳϯϯϬϭϯ ϰ͘ϳϳϱϲϱϮ Ϭ Ϭ͘ϮϭϴϬϴϴ Ϭ͘ϮϰϱϬϳϯ Ϭ Ϭ͘ϬϭϬϰϳϯ Ϭ͘ϬϲϴϮϯϱϬϬϬϬϬ͘ϳϰϴϬϵϰ ϰ͘ϴϳϯϵϬϯϬϬϬϬϭ͘Ϭϲϯ͘ϭϬϭϯϰϯ ϱ͘ϬϬϲϯϮϴ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϱϳ͘ϱϳϮϴϱ ϯϮϲϳ͘ϵϯϭ ϯϮϲϳ͘ϵϯϭ Ϭ ϮϯϬ͘Ϯϵϭϰ Ϭ͘ϵϴϭϰϵϯ Ϭ͘ϵϮϭϯϱϳ Ϭ͘ϲϱϱϯϴϳ Ϭ͘ϬϬϭϮϵϵ Ϭ Ϭ͘ϬϬϬϳϳϳ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϭϰϭϮ Ϭ Ϭ͘ϬϬϬϴϰϱ Ϭ͘ϬϬϴ Ϭ͘Ϭϰϰϵϭϳ ϴϬϳ͘ϴϭϬϴ ϮϱϳϬ͘ϲϵϳ ϲϯ͘ϱϮϰϵϮ Ϭ͘ϬϮϰϳϴϲ Ϯ͘ϰϯϲϱϱ Ϭ͘ϬϵϮϱϱϵ Ϭ͘Ϭϰϱϰϳϳ Ϭ͘Ϭϴϭϵϰϯ Ϭ͘ϬϱϲϮϭϯ Ϭ͘ϭϮϭϭϬϳ ϭϬ͘ϱϲϰϵϰ Ϭ͘ϱϯϴϮϵϮ Ϭ͘ϭϱϰϵϯ Ϭ͘ϰϰϵϱϬϳ Ϯ͘Ϯϯϭϲϵϭ Ϭ͘ϭϳϲϳϮ ϭϱ͘ϰϭϲϯϰ Ϭ͘ϱϴϵϯϲϮ Ϭ͘ϭϱϰϵϯ Ϭ͘ϰϰϵϱϬϳ Ϯ͘Ϯϯϭϲϵϭ Ϭ͘Ϭϰϱ ϯ͘ϭϯϰϲϳϵ ϴϭ͘ϳϳϴϬϮ ϭϯ͘ϳϬϵϬϴ Ϭ͘ϬϬϳϵϴϲ Ϭ͘ϬϮϱϰϭϰ Ϭ͘ϬϬϬϲϮϴ^ĂŶDĂƚĞŽ ϮϬϮϮ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϲϴ͘ϭϱϮϭ ϯϳϵϵ͘ϭϳϭ ϯϳϵϵ͘ϭϳϭ Ϭ Ϯϰϯϰ͘ϴϰϯ ϱ͘ϯϬϴϬϯϵ Ϯϰ͘ϱϬϬϴϴ Ϭ͘ϰϭϱϳϰϱ Ϭ͘ϬϮϱϱϬϵ Ϭ͘ϬϮϳϵϮϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϮϲϲϲϮ Ϭ͘ϬϮϵϭϵ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϭϱϱ͘ϭϴϮ ϮϮϱϲ͘ϵϳϱ Ϭ Ϭ͘ϬϬϯϯϱϭ Ϭ͘ϬϬϴϰϮϳ Ϭ Ϭ͘ϭϴϭϵϵϵ Ϭ͘ϯϱϱϱϴϳ Ϭ Ϭ͘ϬϳϮϭϰϭ Ϭ͘ϭϴϭϰϯϬϬϬϬϬ͘ϬϴϮϭϮϳϬ͘ϮϬϲϱϰϱ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϮϴϳϵϵ Ϭ͘Ϯϭϰϱϰϳ ϰ͘ϭϲϰϱϵϭ Ϭ Ϭ͘ϬϭϬϵϯϵ Ϭ͘ϬϮϭϯϳϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϱ͘ϳϰϳϰϲϰ ϭϰϳ͘ϳϱϱ ϭϰϳ͘ϳϱϱ Ϭ ϴϯ͘ϮϮϯϮϴ Ϭ͘ϱϴϬϬϯϴ ϱ͘Ϯϳϴϴϲϭ Ϭ Ϭ͘ϬϬϯϯϳϴ Ϭ͘Ϭϭϭϭϲϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϯϲϳϰ Ϭ͘ϬϭϮϭϰϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϮϳϬ͘ϬϮϴ ϰϬϳϭ͘Ϭϲ Ϭ ϯ͘ϰϳϯϵϴϵ ϭϱ͘ϯϱϱϬϭ Ϭ Ϭ͘ϮϱϴϵϬϰ Ϭ͘ϴϮϵϵϭϮ Ϭ Ϭ͘Ϭϰϵϲϯϲ Ϭ͘ϮϭϵϯϵϯϬϬϬϬϯ͘ϱϰϱϰϲϭϭϱ͘ϲϳϬϵϭ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϭϭ͘ϴϮϰϲϮ ϮϬ͘ϯϭϴϱϭ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϭ͘Ϭϴϭϯϵ ϰϭϱϯ͘ϯϰϮ ϰϭϱϯ͘ϯϰϮ Ϭ Ϯϰϰ͘ϯϮϱϲ Ϭ͘ϬϱϮϳϯϮ Ϭ Ϭ͘ϱϵϯϱϱϰ Ϭ͘ϬϬϬϵϮϰ Ϭ Ϭ͘ϬϬϬϭϬϭ Ϭ͘ϬϬϮϬϳϯ Ϭ͘ϬϯϮϯϯϯϬ͘ϬϬϭϬϬϱ Ϭ Ϭ͘ϬϬϬϭϭ Ϭ͘ϬϬϴϮϵ Ϭ͘ϬϵϮϯϳϵ ϭϬϮϲ͘ϬϬϰ Ϭ ϰϭ͘ϯϲϱϲϰ Ϭ͘ϬϬϮϮϴϯ Ϭ Ϭ͘Ϭϱϱϴϱ Ϭ͘ϬϬϲϬϬϵ Ϭ Ϭ͘Ϭϳϳϲϰ Ϭ͘ϬϬϲϳϯϴ Ϭ Ϭ͘Ϯϭϲϯϲϭ Ϭ͘Ϭϱϵϭϱϳ Ϭ͘ϬϵϲϬϲ Ϭ͘ϱϵϮϴϰϭ Ϭ͘ϬϬϵϴϯϮ Ϭ Ϭ͘Ϯϯϲϴϴϴ Ϭ͘Ϭϱϵϭϱϳ Ϭ͘ϬϵϲϬϲ Ϭ͘ϱϵϮϴϰϭ Ϭ͘Ϭϰϱ Ϭ͘ϱϲϮϳϳϲ Ϭ ϱ͘ϵϯϵϮϴϲ Ϭ͘ϬϭϬϭϰϯ Ϭ Ϭ͘ϬϬϬϰϬϵ^ĂŶDĂƚĞŽ ϮϬϮϮ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϯϰϭ͘Ϭϰϳϱ Ϯϴϰϳϳ͘ϴϳ Ϯϴϰϳϳ͘ϴϳ Ϭ ϭϯϲϰ͘ϭϵ Ϯ͘ϵϬϯϭϲϳ Ϭ Ϭ Ϭ͘ϬϬϳϲϮϮ Ϭ Ϭ Ϭ͘ϬϬϳϵϭϯ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϳϵϲϲ Ϭ Ϭ Ϭ͘ϬϯϭϲϱϮ Ϭ͘ϭϭ ϭϰϱϮ͘Ϭϳϵ Ϭ Ϭ Ϭ͘ϬϬϳϯϮ Ϭ Ϭ Ϭ͘ϮϮϴϳϳϲ Ϭ Ϭ Ϭ͘ϭϱϳϱϵϱϬϬϬϬϬϬ͘ϭϳϵϰϬϵ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϮϮϰϯ Ϭ͘ϭϵϯϮϰϴ Ϭ Ϭ Ϭ͘Ϭϭϯϳϱϵ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϮ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯ͘ϬϭϴϳϬϯ ϭϱ͘ϯϭϵϯ Ϭ ϭϱ͘ϯϭϵϯ ϴ͘ϬϳϰϴϭϭϬϬϬϬϬϬϬ͘ϬϬϵϬ͘ϬϭϵϮϱ Ϭ Ϭ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϬϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϮ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϯϰ͘ϲϮϬϰϮ ϭϭϳϰ͘Ϯϱϳ ϭϭϳϰ͘Ϯϱϳ Ϭ ϭϯϴ͘ϰϴϭϳ Ϭ͘Ϭϲϯϱϰϯ Ϭ Ϭ Ϭ͘ϬϬϬϮϵϲ Ϭ Ϭ Ϭ͘ϬϬϴϴϬϳ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϬϯϭ Ϭ Ϭ Ϭ͘ϬϯϱϮϮϵ Ϭ͘ϭϭ ϭϯϱϬ͘ϴϴϭ Ϭ Ϭ ϰ͘ϰϱϭϴϬϴ Ϭ Ϭ Ϭ͘Ϯϳϱϯϴϲ Ϭ Ϭ Ϭ͘ϬϲϯϲϬϴϬϬϬϬϬϰ͘ϱϰϯϯϵϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϵϳ ϱϮ͘ϲϰϭϬϵ Ϭ Ϭ Ϭ Ϭ Ϭ ^ŽƵƌĐĞ͗D&ϮϬϮϭ;ǀϭ͘Ϭ͘ϮͿŵŝƐƐŝŽŶZĂƚĞƐZĞŐŝŽŶdǇƉĞ͗ŽƵŶƚǇZĞŐŝŽŶ͗^ĂŶDĂƚĞŽĂůĞŶĚĂƌzĞĂƌ͗ϮϬϮϯ^ĞĂƐŽŶ͗ŶŶƵĂůsĞŚŝĐůĞůĂƐƐŝĨŝĐĂƚŝŽŶ͗D&ϮϬϬϳĂƚĞŐŽƌŝĞƐhŶŝƚƐ͗ŵŝůĞƐͬĚĂǇĨŽƌsDdĂŶĚsDd͕ƚƌŝƉƐͬĚĂǇĨŽƌdƌŝƉƐ͕ŐͬŵŝůĞĨŽƌZhEy͕WDtĂŶĚWDdt͕ŐͬƚƌŝƉĨŽƌ^dZy͕,Kd^K<ĂŶĚZhE>K^^͕ŐͬǀĞŚŝĐůĞͬĚĂǇĨŽƌ/>yĂŶĚ/hZE͘W,sĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŽƚĂůsDd͘ZĞŐŝŽŶ ĂůĞŶĚĂƌz sĞŚŝĐůĞĂƚDŽĚĞůzĞĂ ^ƉĞĞĚ &ƵĞů WŽƉƵůĂƚŝŽŶdŽƚĂůsDd sDd sDd dƌŝƉƐ EKǆͺZhEEKǆͺ/>yEKǆͺ^dZyWDϮ͘ϱͺZh WDϮ͘ϱͺ/>WDϮ͘ϱͺ^dZWDϮ͘ϱͺWDWDϮ͘ϱͺWDWDϭϬͺZhEWDϭϬͺ/>WDϭϬͺ^dZ WDϭϬͺWDdWDϭϬͺWDKϮͺZhEKϮͺ/>yKϮͺ^dZy,ϰͺZhE,ϰͺ/>y,ϰͺ^dZyEϮKͺZhEEϮKͺ/>yEϮKͺ^dZyZK'ͺZhEZK'ͺ/>yZK'ͺ^dZyZK'ͺ,Kd^ZK'ͺZhE>ZK'ͺ/hZdK'ͺZhEdK'ͺ/>ydK'ͺ^dZydK'ͺ,Kd^dK'ͺZhE>dK'ͺ/hZ E,ϯͺZhEKͺZhEyKͺ/>y Kͺ^dZy ^KǆͺZhE ^Kǆͺ/>y ^Kǆͺ^dZy^ĂŶDĂƚĞŽ ϮϬϮϯ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϰ͘ϯϬϯϴϵϭ ϱϵϯ͘ϯϮϲϱ ϱϵϯ͘ϯϮϲϱ Ϭ ϴϲ͘ϭϭϮϮϱ ϰ͘ϬϱϲϬϴϵ Ϭ Ϭ͘ϬϬϮϴ Ϭ͘ϬϬϭϰϮ Ϭ Ϭ͘ϬϬϬϴϯϰ Ϭ͘ϬϬϱ Ϭ͘Ϭϯϭϭϰϵ Ϭ͘ϬϬϭϱϰϰ Ϭ Ϭ͘ϬϬϬϵϬϳ Ϭ͘ϬϮ Ϭ͘Ϭϴϴϵϵϲ ϮϮϱϴ͘ϭϴϰ Ϭ ϱϰ͘ϰϴϰϵϮ Ϭ͘ϭϭϰϰϵϭ Ϭ Ϭ͘ϬϬϬϭϭϴ Ϭ͘ϭϱϬϮϰϵ Ϭ Ϭ͘ϬϬϬϭϯϱ Ϭ͘ϱϴϭϯϳϲ Ϭ Ϭ͘ϬϬϬϲϯϴ Ϭ͘Ϭϰϭϴϯϴ Ϭ͘ϯϯϱϱϮϰ Ϯ͘ϵϯϵϮϱϳ Ϭ͘ϴϰϴϯϰϮ Ϭ Ϭ͘ϬϬϬϲϵϵ Ϭ͘Ϭϰϭϴϯϴ Ϭ͘ϯϯϱϱϮϰ Ϯ͘ϵϯϵϮϱϳ Ϭ͘Ϭϰϱ ϯϯ͘Ϯϴϳϴϵ Ϭ ϲ͘ϬϲϵϮϵϰ Ϭ͘ϬϮϮϯϮϰ Ϭ Ϭ͘ϬϬϬϱϯϵ^ĂŶDĂƚĞŽ ϮϬϮϯ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϮϵϱ͘ϳϮ ϭϭϵϬϳϵ͘ϲ ϭϭϵϬϳϵ͘ϲ Ϭ ϭϰϬϮϳ͘ϲϲ Ϯ͘ϴϴϵϴϲϮ ϰϳ͘ϬϮϴϬϵ Ϯ͘ϴϳϲϴϬϴ Ϭ͘ϬϮϱϰϯϮ Ϭ͘Ϭϯϳϴϱϴ Ϭ Ϭ͘ϬϬϴϲϬϵ Ϭ͘ϬϯϬϵϰϯ Ϭ͘ϬϮϲϱϴϮ Ϭ͘Ϭϯϵϱϳ Ϭ Ϭ͘Ϭϯϰϰϯϰ Ϭ͘Ϭϴϴϰϭ ϭϴϰϯ͘ϳϳϰ ϴϮϵϭ͘ϲϭϱ Ϭ Ϭ͘ϬϬϭϯϮϮ Ϭ͘ϭϱϲϮϭϳ Ϭ Ϭ͘ϮϵϬϰϴϳ ϭ͘ϯϬϲϯϰϳ Ϭ Ϭ͘ϬϮϴϰϲϯ ϯ͘ϯϲϯϯϭϲ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϯϮϰϬϯ ϯ͘ϴϮϴϴϳϵ Ϭ Ϭ Ϭ ϬϬ͘ϭϵϳϳϰϭ Ϭ͘ϭϮϯϴϲϵ ϰϲ͘ϱϴϬϬϲ Ϭ Ϭ͘Ϭϭϳϰϱϵ Ϭ͘Ϭϳϴϱϭϳ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϭ͘ϳϯϴϳϴϭ ϰϬ͘ϴϭϭϴϳ ϬϰϬ͘ϴϭϭϴϳ ϵ͘ϲϯϲϱϴϵ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴϲϲϲ Ϭ͘Ϭϭϯϳϴ Ϭ Ϭ Ϭ Ϭ͘Ϭϯϰϲϲϯ Ϭ͘ϬϯϵϯϳϮϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϱϳ͘ϱϲϱϱ ϭϬϲϬϮ͘ϳϮ ϭϬϲϬϮ͘ϳϮ Ϭ ϭϬϲϳ͘ϯϲϴ ϭ͘ϲϱϬϮϲϴ ϭϬ͘ϭϮϯϮ Ϭ Ϭ͘ϬϬϭϴϵϳ Ϭ͘ϬϭϮϭϲϳ Ϭ Ϭ͘ϬϬϵ Ϭ͘Ϭϱϴϱϳϱ Ϭ͘ϬϬϮϬϲϯ Ϭ͘ϬϭϯϮϯϮ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϭϲϳϯϱϳ ϭϱϮϮ͘ϱϵϯ ϴϰϵϬ͘ϱϯϯ Ϭ ϯ͘ϯϰϯϬϱϰ Ϯϱ͘ϱϲϳϱϭ Ϭ Ϭ͘ϯϭϬϯϵϭ ϭ͘ϳϯϬϴϱϭ Ϭ Ϭ͘Ϭϳϲϵϳϯ Ϭ͘ϰϭϴϭϯϱ Ϭ Ϭ Ϭ Ϭ ϯ͘ϰϰϱϭϬϵ Ϯϲ͘ϭϱϯϳ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϳϯϳϭϭ ϭϳ͘ϰϭϮϮϵ ϲϲ͘ϰϭϮϱϲ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϮϰϬϯϳϴ͘ϴ ϳϳϮϳϱϯϳ ϳϳϮϳϱϯϳ Ϭ ϭϭϮϵϯϱϱ Ϭ͘ϬϰϮϯϯϴ Ϭ Ϭ͘ϮϲϬϱϬϲ Ϭ͘ϬϬϭϭϵϴ Ϭ Ϭ͘ϬϬϮϬϯϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϰϴ Ϭ͘ϬϬϭϯϬϯ Ϭ Ϭ͘ϬϬϮϮϬϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϳϬϴ Ϯϳϲ͘ϱϴϰ Ϭ ϳϬ͘ϰϳϴϲϵ Ϭ͘ϬϬϮϮϲϳ Ϭ Ϭ͘ϬϳϮϱϯϰ Ϭ͘ϬϬϰϱϭϳ Ϭ Ϭ͘ϬϯϮϯϱϭ Ϭ͘ϬϬϴϴϳϰ Ϭ Ϭ͘ϯϰϭϲϰϵ Ϭ͘ϬϴϳϬϲϮ Ϭ͘ϮϮϮϮϰϳ ϭ͘ϯϮϰϳϬϳ Ϭ͘ϬϭϮϵϰϴ Ϭ Ϭ͘ϯϳϰϬϲϭ Ϭ͘ϬϴϳϬϲϮ Ϭ͘ϮϮϮϮϰϳ ϭ͘ϯϮϰϳϬϳ Ϭ͘ϬϯϱϰϬϴ Ϭ͘ϲϳϳϳϰϵ Ϭ ϯ͘ϯϵϱϲϰϵ Ϭ͘ϬϬϮϳϯϰ ϬϬ͘ϬϬϬϲϵϳ^ĂŶDĂƚĞŽ ϮϬϮϯ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϴϯϯ͘ϳϲϭϮ ϭϵϵϬϲ͘ϱϮ ϭϵϵϬϲ͘ϱϮ Ϭ ϯϱϮϴ͘ϭϵϭ Ϭ͘Ϯϭϯϳϲϰ Ϭ Ϭ Ϭ͘ϬϭϰϯϲϮ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϵϴ Ϭ͘ϬϭϱϬϭϮ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϴϱϭ Ϯϯϰ͘ϰϵϴϭ Ϭ Ϭ Ϭ͘ϬϬϭϭϲϰ Ϭ Ϭ Ϭ͘Ϭϯϲϵϰϱ Ϭ Ϭ Ϭ͘ϬϮϱϬϳϬϬϬϬϬϬ͘ϬϮϴϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϯϭϳϭϭϴ Ϭ Ϭ Ϭ͘ϬϬϮϮϮϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϲϮϵϵ ϲϯϬϰϭϵ͘ϲ Ϭ ϲϯϬϰϭϵ͘ϲ ϴϭϮϰϬ͘ϵϵ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϵ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϲϵϯϬ͘ϰϭϰ Ϯϲϰϱϴϳ͘ϲ ϭϯϭϳϲϳ͘ϵ ϭϯϮϴϭϵ͘ϴ Ϯϴϲϱϳ͘Ϯϲ Ϭ͘ϬϬϯϭϵϵ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϲϭϱ Ϭ Ϭ͘ϬϬϮϬϲϱ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϭϴ Ϭ͘ϬϬϬϲϲϵ Ϭ Ϭ͘ϬϬϮϮϰϲ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϲϲ ϭϯϰ͘ϰϬϲϭ Ϭϲϱ͘ϮϰϱϬϯ Ϭ͘ϬϬϬϰϭϱ Ϭ Ϭ͘ϬϰϮϰϱϭ Ϭ͘ϬϬϬϱϱϲ Ϭ Ϭ͘ϬϮϬϯϰ Ϭ͘ϬϬϭϯϰϱ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϯϳϬϱ Ϭ͘ϬϯϮϴϵϲ Ϭ͘ϯϵϮϰϮϳ Ϭ͘ϬϬϭϵϲϮ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϯϳϬϱ Ϭ͘ϬϯϮϴϵϲ Ϭ͘ϯϵϮϰϮϳ Ϭ͘Ϭϭϵϲϵϲ Ϭ͘ϮϬϬϳϳϮ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϯϮϵ Ϭ Ϭ͘ϬϬϬϲϰϱ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϰϱϱϳ͘ϲϭ ϳϯϮϮϵϳ͘ϴ ϳϯϮϮϵϳ͘ϴ Ϭ ϭϭϭϴϱϱ͘ϯ Ϭ͘ϭϭϲϯϴ Ϭ Ϭ͘ϯϲϰϱϳϴ Ϭ͘ϬϬϭϲϰϵ Ϭ Ϭ͘ϬϬϮϲϬϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϮϵ Ϭ͘ϬϬϭϳϵϰ Ϭ Ϭ͘ϬϬϮϴϮϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϴϮ ϯϮϰ͘ϰϮϳϵ Ϭ ϴϱ͘ϰϮϵϬϳ Ϭ͘ϬϬϱϰϰϴ Ϭ Ϭ͘ϬϵϵϴϰϮ Ϭ͘ϬϬϴϰϵϵ Ϭ Ϭ͘ϬϯϳϬϮϮ Ϭ͘ϬϮϰϮϴϵ Ϭ Ϭ͘ϱϭϯϵϮϵ Ϭ͘ϭϰϱϱϳ Ϭ͘ϰϭϲϯϳϵ Ϯ͘Ϯϵϰϰϯϰ Ϭ͘Ϭϯϱϰϯϱ ϬϬ͘ϱϲϮϲϴϳ Ϭ͘ϭϰϱϱϳ Ϭ͘ϰϭϲϯϳϵ Ϯ͘Ϯϵϰϰϯϰ Ϭ͘ϬϯϳϬϮϮ ϭ͘Ϯϭϳϵϴϴ Ϭ ϱ͘ϬϵϯϬϬϵ Ϭ͘ϬϬϯϮϬϳ Ϭ Ϭ͘ϬϬϬϴϰϱ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϳ͘ϲϱϱϲϬϭ ϭϬϭ͘ϵϭϴϱ ϭϬϭ͘ϵϭϴϱ Ϭ ϮϮ͘ϮϬϭϳϯ ϭ͘ϲϳϲϬϴϲ Ϭ Ϭ Ϭ͘Ϯϯϵϯϲϴ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϯϯϯϮ Ϭ͘ϮϱϬϭϵϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϱϮ ϰϭϴ͘ϭϱϮ Ϭ Ϭ Ϭ͘Ϭϭϰϳϯϵ Ϭ Ϭ Ϭ͘Ϭϲϱϴϴ Ϭ Ϭ Ϭ͘ϯϭϳϯϮϳϬϬϬϬϬϬ͘ϯϲϭϮϱϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ ϭ͘ϲϴϴϭϲϴ Ϭ Ϭ Ϭ͘ϬϬϯϵϲϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϳϰ͘ϲϮϯϭϭ Ϯϱϳϰ͘ϳϳ Ϭ Ϯϱϳϰ͘ϳϳ ϯϱϳ͘ϵϱϮϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϯϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϴϲϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϯϰ͘ϲϳϬϳϯ ϭϰϱϭ͘ϯϭ ϲϲϴ͘ϯϬϳϴ ϳϴϯ͘ϬϬϮϰ ϭϰϯ͘ϯϲϯϱ Ϭ͘ϬϬϮϵϱϴ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϴϯ Ϭ Ϭ͘ϬϬϭϰϬϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯϭ Ϭ͘ϬϬϬϰϭϲ Ϭ Ϭ͘ϬϬϭϱϮϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϬϮ ϭϮϰ͘Ϯϵϵϯ Ϭ ϳϬ͘ϴϵϱϰϴ Ϭ͘ϬϬϬϯϴϱ Ϭ Ϭ͘ϬϰϮϱϯϭ Ϭ͘ϬϬϬϱϭϱ Ϭ Ϭ͘ϬϮϬϰϭϰ Ϭ͘ϬϬϭϮϰϯ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϰϯϴϯ Ϭ͘ϬϮϭϱϴ Ϭ͘Ϯϳϰϴϰϵ Ϭ͘ϬϬϭϴϭϰ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϰϯϴϯ Ϭ͘ϬϮϭϱϴ Ϭ͘Ϯϳϰϴϰϵ Ϭ͘Ϭϭϵϯϰ Ϭ͘ϭϴϱϳϰϵ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϮϵ Ϭ Ϭ͘ϬϬϬϳϬϭ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϯϵϮϮϮ͘ϯ ϰϳϭϲϴϴϴ ϰϳϭϲϴϴϴ Ϭ ϲϲϴϮϲϲ͘ϭ Ϭ͘ϬϱϰϬϴ Ϭ Ϭ͘Ϯϵϳϭϯ Ϭ͘ϬϬϭϮϬϳ Ϭ Ϭ͘ϬϬϭϵϰϵ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϭϲ Ϭ͘ϬϬϭϯϭϯ Ϭ Ϭ͘ϬϬϮϭϭϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϳϱϵ ϯϯϰ͘ϴϵϴϲ Ϭ ϴϱ͘ϯϬϯϬϭ Ϭ͘ϬϬϮϯϳ Ϭ Ϭ͘Ϭϳϱϴϰϱ Ϭ͘ϬϬϰϵϱϵ Ϭ Ϭ͘Ϭϯϰϳϭϲ Ϭ͘ϬϬϵϭϭϯ Ϭ Ϭ͘ϯϰϳϵϴϰ Ϭ͘ϬϲϯϲϮϵ Ϭ͘ϭϲϬϳϴϭ ϭ͘ϬϬϳϰϯϳ Ϭ͘ϬϭϯϮϵϳ Ϭ Ϭ͘ϯϴϬϵϵϵ Ϭ͘ϬϲϯϲϮϵ Ϭ͘ϭϲϬϳϴϭ ϭ͘ϬϬϳϰϯϳ Ϭ͘Ϭϯϳϳϰϴ Ϭ͘ϲϵϯϱϲϯ Ϭ ϯ͘ϰϴϬϱϭϱ Ϭ͘ϬϬϯϯϭϭ ϬϬ͘ϬϬϬϴϰϯ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϱϰϭ͘ϲϴϵϰ ϭϴϮϴϬ͘ϵϴ ϭϴϮϴϬ͘ϵϴ Ϭ ϮϲϬϵ͘Ϭϯϭ Ϭ͘ϬϰϮϳϱϵ Ϭ Ϭ Ϭ͘ϬϬϰϲϵϰ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϯϵ Ϭ͘ϬϬϰϵϬϲ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϮϱ ϯϭϬ͘ϰϱϴ Ϭ Ϭ Ϭ͘ϬϬϬϱϵϰ Ϭ Ϭ Ϭ͘Ϭϰϴϵϭϯ Ϭ Ϭ Ϭ͘ϬϭϮϳϵϭϬϬϬϬϬϬ͘ϬϭϰϱϲϮ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϮϭϬϱϴ Ϭ Ϭ Ϭ͘ϬϬϮϵϰϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϴϱϱ͘ϬϱϮϭ Ϯϲϴϳϳ͘ϰϯ ϬϮϲϴϳϳ͘ϰϯ ϰϯϴϵ͘ϵϯϰ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϰ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϭϮϵϯ͘ϮϮϵ ϱϮϮϯϱ͘ϵϲ Ϯϰϵϱϵ͘ϭ ϮϳϮϳϲ͘ϴϲ ϱϯϰϳ͘ϱϬϮ Ϭ͘ϬϬϯϬϳ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϳϴϬ Ϭ͘ϬϬϭϲϴϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϮϱ Ϭ͘ϬϬϬϱϮ Ϭ Ϭ͘ϬϬϭϴϯϲ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϴϱ ϭϮϴ͘ϵϳ Ϭ ϳϲ͘ϳϰϬϴϰ Ϭ͘ϬϬϬϯϵϵ Ϭ Ϭ͘ϬϰϮϱϯϳ Ϭ͘ϬϬϬϱϯϱ Ϭ Ϭ͘ϬϮϬϰϮ Ϭ͘ϬϬϭϮϵ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϱϲϲϯ Ϭ͘ϬϮϯϳϳ Ϭ͘ϮϵϵϮϭϭ Ϭ͘ϬϬϭϴϴϯ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϱϲϲϯ Ϭ͘ϬϮϯϳϳ Ϭ͘ϮϵϵϮϭϭ Ϭ͘ϬϮϬϬϰϳ Ϭ͘ϭϵϮϳϬϰ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϳϱ Ϭ Ϭ͘ϬϬϬϳϱϵ^ĂŶDĂƚĞŽ ϮϬϮϯ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϬϱϳϮ͘Ϭϴ ϯϵϮϱϯϯ͘ϭ ϯϵϮϱϯϯ͘ϭ Ϭ ϭϱϳϱϬϴ͘Ϯ Ϭ͘ϭϮϱϮϴ Ϭ͘ϬϯϱϭϭϮ Ϭ͘ϱϵϳϴϰ Ϭ͘ϬϬϭϰϮ Ϭ Ϭ͘ϬϬϬϮϱϯ Ϭ͘ϬϬϮ Ϭ͘ϬϮϳϯϬ͘ϬϬϭϱϰϱ Ϭ Ϭ͘ϬϬϬϮϳϱ Ϭ͘ϬϬϴ Ϭ͘Ϭϳϴ ϴϱϯ͘ϰϵϯϮ ϭϭϳ͘ϴϴϯ Ϯϲ͘ϵϳϲϵϯ Ϭ͘ϬϬϲϯϮϭ Ϭ͘ϭϭϭϭϳϳ Ϭ͘ϬϯϬϰϮϭ Ϭ͘ϬϬϳϭϱ Ϭ͘ϬϬϮϵϵϳ Ϭ͘ϬϱϬϬϭϮ Ϭ͘ϬϯϬϵϭ Ϭ͘ϰϬϮϱ Ϭ͘ϭϰϴϯϴϰ Ϭ͘ϬϯϲϵϮϰϬ͘ϭϵϴϵϮϮ Ϯ͘ϬϭϰϰϬϰ Ϭ͘ϬϰϱϭϬϰ Ϭ͘ϱϴϳϯϮϳ Ϭ͘ϭϲϮϰϲϮ Ϭ͘ϬϯϲϵϮϰ Ϭ͘ϭϵϴϵϮϮ Ϯ͘ϬϭϰϰϬϰ Ϭ͘Ϭϰϰϵϯϳ Ϭ͘ϵϴϲϰϯϵ ϯ͘ϳϲϭϱϲϱ ϯ͘ϯϭϴϬϳϲ Ϭ͘ϬϬϴϰϯϴ Ϭ͘ϬϬϭϭϲϱ Ϭ͘ϬϬϬϮϲϳ^ĂŶDĂƚĞŽ ϮϬϮϯ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϱϳϳ͘ϭϬϵ ϭϳϵϲϴϲ͘ϱ ϭϳϵϲϴϲ͘ϱ Ϭ ϱϳϱϳϰ͘Ϯϳ ϭ͘ϮϮϰϳϭϳ ϭ͘ϳϲϮϬϲ Ϭ Ϭ͘ϬϮϳϯ Ϭ͘ϬϮϲϵϰϮ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϮϳϯ Ϭ͘ϬϮϴϱϯϰ Ϭ͘ϬϮϴϭϲ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϳϴ ϲϯϬ͘ϲϭϵϮ ϭϮϵ͘ϬϯϵϮ Ϭ Ϭ͘ϬϬϲϲϵϳ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘Ϭϵϵϯϱϰ Ϭ͘ϬϮϬϯϯ Ϭ Ϭ͘ϭϰϰϭϴϳ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϲϰϭϰϳ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϴϰϱϰϲ Ϭ͘ϯϳϭϵϱϯ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϱϵϳϱ Ϭ͘ϬϬϭϮϮϯ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϮϯϭ͘Ϯϯϲ ϰϯϱϰϵ͘ϵϰ ϰϯϱϰϵ͘ϵϰ Ϭ ϭϴϯϰϯ͘ϱϵ Ϭ͘ϭϰϰ Ϭ͘Ϭϯϰϰϯ Ϭ͘ϲϬϱϮϲϮ Ϭ͘ϬϬϭϯϲϴ Ϭ Ϭ͘ϬϬϬϮϮϲ Ϭ͘ϬϬϮ Ϭ͘ϬϯϭϴϱϬ͘ϬϬϭϰϴϳ Ϭ Ϭ͘ϬϬϬϮϰϲ Ϭ͘ϬϬϴ Ϭ͘Ϭϵϭ ϵϲϯ͘ϲϵϬϱ ϭϯϲ͘ϲϴϱϭ Ϯϱ͘ϲϬϬϯϭ Ϭ͘ϬϬϱϲϴϲ Ϭ͘ϭϬϴϬϮϮ Ϭ͘ϬϯϬϮϵϭ Ϭ͘ϬϬϴϱϯϯ Ϭ͘ϬϬϮϴϮϵ Ϭ͘Ϭϰϴϱϱϰ Ϭ͘ϬϮϲϯϴϮ Ϭ͘ϯϵϰϳϮϮ Ϭ͘ϭϰϴϴϵϭ Ϭ͘Ϭϯϴϳϱϳ Ϭ͘ϮϬϰϱϬϭ Ϯ͘Ϭϴϱϰϭϵ Ϭ͘Ϭϯϴϰϵϲ Ϭ͘ϱϳϱϵϳϳ Ϭ͘ϭϲϯϬϭϳ Ϭ͘Ϭϯϴϳϱϳ Ϭ͘ϮϬϰϱϬϭ Ϯ͘Ϭϴϱϰϭϵ Ϭ͘Ϭϰϰϵϴϵ Ϭ͘ϴϳϴϵϴϵ ϯ͘ϳϲϮϰϵϵ ϯ͘ϯϬϬϲϴϵ Ϭ͘ϬϬϵϱϮϳ Ϭ͘ϬϬϭϯϱϭ Ϭ͘ϬϬϬϮϱϯ^ĂŶDĂƚĞŽ ϮϬϮϯ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϵϱϮ͘ϳϬϵ ϳϳϳϵϴ͘ϵϳ ϳϳϳϵϴ͘ϵϳ Ϭ ϮϰϱϲϮ͘ϲϮ Ϭ͘ϴϴϯϲϴϱ ϭ͘ϲϳϵϰϴϮ Ϭ Ϭ͘ϬϮϯϲϳϳ Ϭ͘ϬϮϲϴϳϮ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϮϰϳϰϳ Ϭ͘ϬϮϴϬϴϳ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϵϭ ϳϰϳ͘ϵϵϵϴ ϮϬϰ͘ϵϵϴϳ Ϭ Ϭ͘ϬϬϲϬϵϴ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϭϳϴϰϴ Ϭ͘ϬϯϮϮϵϴ Ϭ Ϭ͘ϭϯϭϮϴϴ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϰϵϰϲϯ Ϭ͘ϭϮϰϵϱϰϬϬϬϬϬ͘ϭϵϲϯϬϵ Ϭ͘ϯϬϯϵϳϮ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϳϬϴϴ Ϭ͘ϬϬϭϵϰϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ Dz ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϮϱϯϲ͘ϳϳ ϳϯϴϮϬ͘Ϭϰ ϳϯϴϮϬ͘Ϭϰ Ϭ ϮϱϬϳϯ͘ϱϰ Ϭ͘ϱϯϳϭϰϯ Ϭ Ϭ͘ϭϯϲϮϵϭ Ϭ͘ϬϬϭϴϴϯ Ϭ Ϭ͘ϬϬϯϲϲϯ Ϭ͘ϬϬϭ Ϭ͘ϬϬϰϮ Ϭ͘ϬϬϮϬϭϮ Ϭ Ϭ͘ϬϬϯϴϵϰ Ϭ͘ϬϬϰ Ϭ͘ϬϭϮ ϭϴϳ͘ϲϯϵϲ Ϭ ϰϳ͘ϵϬϳϱϮ Ϭ͘ϭϱϭϬϴϱ Ϭ Ϭ͘ϭϴϭϰϮϵ Ϭ͘ϬϯϳϳϯϱϬ Ϭ͘ϬϬϴϬϲϴ Ϭ͘ϵϴϮϰϱ Ϭ ϭ͘ϯϰϳϭϲϵ ϯ͘ϱϱϱϮϭϳ ϯ͘ϳϭϳϭϬϮ ϯ͘ϰϯϱϯϴϭ ϭ͘ϭϴϭϭϯϵ Ϭ ϭ͘ϰϲϰϰϵϴ ϯ͘ϱϱϱϮϭϳ ϯ͘ϳϭϳϭϬϮ ϯ͘ϰϯϱϯϴϭ Ϭ͘ϬϬϴϴϰϰ ϭϭ͘ϱϳϰϰϱ Ϭ ϳ͘ϴϯϴϲϭϯ Ϭ͘ϬϬϭϴϱϱ Ϭ Ϭ͘ϬϬϬϰϳϰ^ĂŶDĂƚĞŽ ϮϬϮϯ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϴϯϵϴ͘ϬϮ ϮϳϬϰϮϳϯ ϮϳϬϰϮϳϯ Ϭ ϯϳϰϰϬϴ Ϭ͘Ϭϲϴϳϰϯ Ϭ Ϭ͘ϯϲϮϵϬϵ Ϭ͘ϬϬϭϮϮϮ Ϭ Ϭ͘ϬϬϮϬϲϵ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϯϰ Ϭ͘ϬϬϭϯϮϵϬ Ϭ͘ϬϬϮϮϱϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϭ ϰϬϯ͘ϲϮϲϮ Ϭ ϭϬϯ͘ϯϰϵϲ Ϭ͘ϬϬϮϴϰϰ Ϭ Ϭ͘ϬϴϵϬϲϰ Ϭ͘ϬϬϱϳϬϯϬ Ϭ͘Ϭϯϳϯϰϵ Ϭ͘Ϭϭϭϲϭ Ϭ Ϭ͘ϰϯϳϳϰϲ Ϭ͘ϬϳϮϯϵϱ Ϭ͘ϭϵϰϲϮϱ ϭ͘ϭϵϬϰϭϭ Ϭ͘ϬϭϲϵϮϲ Ϭ Ϭ͘ϰϳϵϮϳϰ Ϭ͘ϬϳϮϯϵϱ Ϭ͘ϭϵϰϲϮϱ ϭ͘ϭϵϬϰϭϭ Ϭ͘ϬϯϴϬϵϮ Ϭ͘ϳϰϳϯϰϭ Ϭ ϯ͘ϳϯϵϭϴϴ Ϭ͘ϬϬϯϵϵ Ϭ Ϭ͘ϬϬϭϬϮϮ^ĂŶDĂƚĞŽ ϮϬϮϯ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϭϬϳ͘ϵϬϯ ϯϳϵϬϴ͘ϭϯ ϯϳϵϬϴ͘ϭϯ Ϭ ϱϯϬϱ͘ϴϭϴ Ϭ͘Ϭϰϭϳϲ Ϭ Ϭ Ϭ͘ϬϬϰϯϮϴ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϴϴ Ϭ͘ϬϬϰϱϮϰ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϵϲϱ ϰϬϲ͘Ϯϲϭϱ Ϭ Ϭ Ϭ͘ϬϬϬϰϰϵ Ϭ Ϭ Ϭ͘ϬϲϰϬϬϳ Ϭ Ϭ Ϭ͘ϬϬϵϲϲϱϬϬϬϬϬϬ͘ϬϭϭϬϬϮ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϳϱϲϬϮ Ϭ Ϭ Ϭ͘ϬϬϯϴϱ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϵϬϲ͘ϱϭϭϱ Ϯϴϱϰϴ͘ϴϮ Ϭ Ϯϴϱϰϴ͘ϴϮ ϰϲϱϳ͘ϬϮϭϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϰ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϱϰϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϲϳϴ͘ϭϭϳϰ Ϯϳϱϰϳ͘ϴϴ ϭϯϰϰϴ͘ϰϳ ϭϰϬϵϵ͘ϰϭ ϮϴϬϰ͘Ϭϭϱ Ϭ͘ϬϬϯϭϯϲ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϱϳϴ Ϭ Ϭ͘ϬϬϮϬϬϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϮϮ Ϭ͘ϬϬϬϲϮϴ Ϭ Ϭ͘ϬϬϮϭϳϳ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϳϲ ϭϯϭ͘ϳϲϮϭ Ϭϵϱ͘ϱϮϲϴϮ Ϭ͘ϬϬϬϰϬϵ Ϭ Ϭ͘ϬϰϮϲϴ Ϭ͘ϬϬϬϱϱ Ϭ Ϭ͘ϬϮϬϱϱϯ Ϭ͘ϬϬϭϯϭϴ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϳϵϳϲ Ϭ͘ϬϮϲϮϱϴ Ϭ͘ϯϮϱϬϵϭ Ϭ͘ϬϬϭϵϮϯ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϳϵϳϲ Ϭ͘ϬϮϲϮϱϴ Ϭ͘ϯϮϱϬϵϭ Ϭ͘ϬϮϬϱϬϰ Ϭ͘ϭϵϲϴϱϭ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϯϬϯ Ϭ Ϭ͘ϬϬϬϵϰϰ^ĂŶDĂƚĞŽ ϮϬϮϯ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϳϰ͘ϴϭϭϱ ϳϰϰϮ͘ϵϳϲ ϳϰϰϮ͘ϵϳϲ Ϭ ϳϳ͘ϱϭϮϭϱ Ϭ͘ϯϳϱϵϮϳ Ϭ Ϭ͘ϰϬϰϴϵϯ Ϭ͘ϬϬϭϳϭϵ Ϭ Ϭ͘ϬϬϬϰϯϲ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϴϲϵ Ϭ Ϭ͘ϬϬϬϰϳϰ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϵϰϳ͘ϭϳ Ϭ ϯϭ͘ϴϵϯϱϱ Ϭ͘Ϭϭϰϭϳ Ϭ Ϭ͘ϬϯϴϭϬϱ Ϭ͘ϬϮϯϳϲϰ Ϭ Ϭ͘ϬϰϮϱϮϴ Ϭ͘ϬϲϭϯϴϮ Ϭ Ϭ͘ϭϲϮϰϰ ϭϭ͘ϭϭϯϳϭ Ϭ͘Ϯϲϭϵϯϲ ϯ͘ϵϬϮϵϲϲ Ϭ͘Ϭϴϵϱϲϵ Ϭ Ϭ͘ϭϳϳϴϱϮ ϭϭ͘ϭϭϯϳϭ Ϭ͘Ϯϲϭϵϯϲ ϯ͘ϵϬϮϵϲϲ Ϭ͘Ϭϰϰϴϲϭ ϭ͘ϰϵϮϰϱϱ Ϭ ϯ͘ϲϰϯϯϳ Ϭ͘ϬϭϵϮϱ Ϭ Ϭ͘ϬϬϬϯϭϱ^ĂŶDĂƚĞŽ ϮϬϮϯ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϯϮϴ͘ϱϴϮϮ ϯϰϴϳ͘ϮϲϮ ϯϰϴϳ͘ϮϲϮϬ ϯϮ͘ϴϱϴϮϮ ϯ͘ϮϮϵϭϵϳ Ϭ Ϭ Ϭ͘Ϭϱϱϰϱϱ Ϭ Ϭ Ϭ͘ϬϬϰ Ϭ͘Ϭϭϱϲϳϱ Ϭ͘ϬϱϳϵϲϮ Ϭ Ϭ Ϭ͘Ϭϭϲ Ϭ͘Ϭϰϰϳϴϱ ϭϬϴϱ͘ϯϰϵ Ϭ Ϭ Ϭ͘ϬϬϰϯϳϳ Ϭ Ϭ Ϭ͘ϭϳϬϵϵϳ Ϭ Ϭ Ϭ͘ϬϵϰϮϰϮϬϬϬϬϬϬ͘ϭϬϳϮϴϴ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϴϱϵϳϳ Ϭ͘Ϯϵϳϵϵϯ Ϭ Ϭ Ϭ͘ϬϭϬϮϴϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϴϬ͘ϭϵϮϰ ϰϱϵϵϴ͘Ϯϵ ϰϱϵϵϴ͘Ϯϵ Ϭ ϭϱϲϭϬ͘Ϭϵ Ϭ͘ϰϴϬϲϯ Ϭ͘Ϭϴϴϰϴϱ Ϭ͘ϰϱϯϲϴ Ϭ͘ϬϬϭϯϳϳ Ϭ Ϭ͘ϬϬϬϱϰϮ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϰϵϴ Ϭ Ϭ͘ϬϬϬϱϵ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϳϲϯ͘ϵϰϱ ϱϯϬ͘ϯϯϮϲ ϰϲ͘ϯϵϰϵϰ Ϭ͘ϬϭϱϱϭϵϬ͘Ϯϲϭϰϲϵ Ϭ͘ϬϰϵϬϵϮ Ϭ͘ϬϮϯϱϲϱ Ϭ͘ϬϬϳϯϳ Ϭ͘Ϭϯϰϰϯϲ Ϭ͘Ϭϳϲϱϳϯ ϭ͘ϬϭϮϲϵϱ Ϭ͘ϮϳϬϱϳϰϬ͘Ϭϯϯϱϳϭ Ϭ͘Ϯϳϰϲϳϭ Ϯ͘ϱϵϴϵϴϮ Ϭ͘ϭϭϭϳϯϲ ϭ͘ϰϳϳϳϮϮ Ϭ͘ϮϵϲϮϰϱ Ϭ͘Ϭϯϯϱϳϭ Ϭ͘Ϯϳϰϲϳϭ Ϯ͘ϱϵϴϵϴϮ Ϭ͘Ϭϰϰϵϳϵ ϭ͘ϱϵϵϵϯϮ ϭϱ͘ϭϭϲϮϯ ϱ͘ϵϳϭϭϯ Ϭ͘Ϭϭϳϰϯϴ Ϭ͘ϬϬϱϮϰϯ Ϭ͘ϬϬϬϰϱϵ^ĂŶDĂƚĞŽ ϮϬϮϯ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϭϴϵ͘ϰϰϯ ϭϳϱϵϬϭ͘Ϯ ϭϳϱϵϬϭ͘Ϯ Ϭ ϱϬϰϲϮ͘ϰϵ ϭ͘ϰϮϲϰϴ ϭϰ͘Ϭϵϰϳϱ ϭ͘ϱϴϲϬϱϯ Ϭ͘ϬϭϴϳϴϮ Ϭ͘ϬϰϬϬϭϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϵϴϯ Ϭ͘Ϭϭϵϲϯϭ Ϭ͘ϬϰϭϴϮϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϲϲϱ ϭϭϱϱ͘ϵϭϵ ϮϮϲϰ͘ϯϱϭ Ϭ Ϭ͘ϬϬϮϬϬϵ Ϭ͘ϬϭϮϳϳϵ Ϭ Ϭ͘ϭϴϮϭϭϱ Ϭ͘ϯϱϲϳϰϵ Ϭ Ϭ͘ϬϰϯϮϰϴ Ϭ͘ϮϳϱϭϮϭϬϬϬϬϬ͘ϬϰϵϮϯϰ Ϭ͘ϯϭϯϮϬϱϬϬϬϬϬ͘ϮϬϲϵϭϴ Ϭ͘ϭϰϴϳϯϰ ϳ͘ϱϳϵϭϵϱ Ϭ Ϭ͘ϬϭϬϵϰϲ Ϭ͘ϬϮϭϰϰϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯ͘ϬϱϵϮϵϰ ϰϰ͘ϭϭϭϬϰ Ϭϰϰ͘ϭϭϭϬϰ Ϯϱ͘ϱϲϱϵϲϬϬϬϬϬϬϬ͘ϬϬϯϬ͘ϬϬϳϵϵϭ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϴϯϯϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϯϴ͘ϭϯϱϬϴ ϭϴϯϮ͘ϳϳ ϭϴϯϮ͘ϳϳ Ϭ ϯϰϮ͘ϮϬϳϱ Ϭ͘ϭϯϮϵϱϭ ϲ͘ϲϬϵϱϰϰ Ϭ Ϭ͘ϬϬϭϮϮϴ Ϭ͘Ϭϭϴϲϱϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϲϬϵϰ Ϭ͘ϬϬϭϯϯϲ Ϭ͘ϬϮϬϮϵϯ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϵϴϮ ϭϬϬϴ͘ϰϬϴ ϱϰϱϴ͘ϴϴϰ Ϭ Ϭ͘ϳϲϵϰϳϳ ϭϳ͘ϱϮϲϭϭ Ϭ Ϭ͘ϮϬϱϱϳ ϭ͘ϭϭϮϴϮϵ Ϭ Ϭ͘ϬϭϬϵϵϰ Ϭ͘ϮϱϬϰϭϰϬϬϬϬϬ͘ϳϴϱϯϬϳ ϭϳ͘ϴϴϲϲϴϬϬϬϬϭ͘Ϭϲϯ͘Ϭϲϰϳϯϱ ϯϱ͘ϴϭϴϬϯ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϱϲ͘ϱϲϬϳ ϭϱϭϳϳ͘Ϭϰ ϭϱϭϳϳ͘Ϭϰ Ϭ ϱϭϯϯ͘Ϯϲϳ Ϭ͘ϯϬϴϭϬϲ Ϭ͘ϬϲϱϬϲϯ Ϭ͘ϯϲϵϰϱϯ Ϭ͘ϬϬϭ Ϭ Ϭ͘ϬϬϬϮϴϳ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϲϴϬ͘ϬϬϭϬϴϴ Ϭ Ϭ͘ϬϬϬϯϭϮ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϳϵϵ ϭϳϰϮ͘Ϯϳϲ ϯϳϯ͘ϲϯϱϰ ϯϬ͘ϮϳϳϬϰ Ϭ͘ϬϬϵϱϵϱ Ϭ͘ϮϬϱϱϲϰ Ϭ͘Ϭϯϯϭϱϳ Ϭ͘ϬϭϳϮϴϭ Ϭ͘ϬϬϱϵϬϯ Ϭ͘Ϭϯϭϴϵϰ Ϭ͘ϬϰϱϰϬϱ Ϭ͘ϳϰϲϮϳϵ Ϭ͘ϭϲϯϴϳϴϬ͘ϬϮϲϰϴϭ Ϭ͘ϭϭϯϯϱϮ ϭ͘ϵϬϮϯϬϳ Ϭ͘ϬϲϲϮϱϱ ϭ͘Ϭϴϴϵϲϵ Ϭ͘ϭϳϵϰϮϱ Ϭ͘ϬϮϲϰϴϭ Ϭ͘ϭϭϯϯϱϮ ϭ͘ϵϬϮϯϬϳ Ϭ͘Ϭϰϰϵϭϵ Ϭ͘ϵϴϱϴϴϳ ϱ͘ϳϳϰϳϬϳ ϯ͘ϰϲϬϯϬϭ Ϭ͘ϬϭϳϮϮϰ Ϭ͘ϬϬϯϲϵϰ Ϭ͘ϬϬϬϮϵϵ^ĂŶDĂƚĞŽ ϮϬϮϯ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϬϱϭ͘ϳϵϵ ϳϰϳϰϲ͘ϵϱ ϳϰϳϰϲ͘ϵϱ Ϭ ϭϬϮϴϴ͘ϭϴ Ϭ͘ϴϰϯϲϴϲ ϱ͘ϳϳϵϱϰϴ ϭ͘ϱϬϴϵϯϲ Ϭ͘ϬϬϵϱϲϱ Ϭ͘ϬϬϯϯϳϴ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϳϯϳϲ Ϭ͘ϬϬϵϵϵϴ Ϭ͘ϬϬϯϱϯϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϵϲϰϳ ϭϮϱϬ͘ϴϵϱ ϭϮϮϱ͘ϳϴϰ Ϭ Ϭ͘ϬϬϬϵϰϳ Ϭ͘Ϭϭϯϵϵϱ Ϭ Ϭ͘ϭϵϳϬϳϵ Ϭ͘ϭϵϯϭϮϯ Ϭ Ϭ͘ϬϮϬϯϵϴ Ϭ͘ϯϬϭϯϭϯϬϬϬϬϬ͘ϬϮϯϮϮϮ Ϭ͘ϯϰϯϬϮϮϬϬϬϬϬ͘Ϯϭϳϲϯϭ Ϭ͘Ϭϵϰϭϲϲ ϱ͘ϲϮϵϳϵϰ Ϭ Ϭ͘Ϭϭϭϴϰϱ Ϭ͘ϬϭϭϲϬϳ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲ͘ϲϲϬϵϵϰ ϰϭϱ͘ϭϰϱϮ ϰϭϱ͘ϭϰϱϮ Ϭ ϱϵ͘ϮϴϮϴϱ Ϭ͘ϮϯϮϵϰϴ ϭ͘ϱϱϲϴϴϮ Ϭ Ϭ͘ϬϬϬϴϱϲ Ϭ͘ϬϬϯϰϯϱ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϲϭϰϴ Ϭ͘ϬϬϬϵϯϭ Ϭ͘ϬϬϯϳϯϲ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϲϭϯϳ ϭϬϮϵ͘ϯϲ ϭϭϵϰ͘Ϯϰϴ Ϭ Ϭ͘ϳϲϲϯϰϳ ϰ͘ϰϳϳϮϱϱ Ϭ Ϭ͘ϮϬϵϴϰϮ Ϭ͘Ϯϰϯϰϱϱ Ϭ Ϭ͘ϬϭϬϵϱ Ϭ͘ϬϲϯϵϳϭϬϬϬϬϬ͘ϳϴϮϭϭϯ ϰ͘ϱϲϵϯϲϳϬϬϬϬϭ͘Ϭϲϯ͘ϭϵϭϭϱϲ͘ϯϬϲϬϵϲ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϮ͘ϭϭϮϴϴ ϯϰϭϭ͘ϵϮϯ ϯϰϭϭ͘ϵϮϯ Ϭ Ϯϰϴ͘ϰϱϭϱ Ϭ͘ϴϵϳϲϱϲ Ϭ͘ϵϮϯϮϴϴ Ϭ͘ϲϰϯϯϭϳ Ϭ͘ϬϬϭϭϲϰ Ϭ Ϭ͘ϬϬϬϳϮϭ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϭϮϲϲ Ϭ Ϭ͘ϬϬϬϳϴϰ Ϭ͘ϬϬϴ Ϭ͘Ϭϰϰϵϭϳ ϳϵϳ͘ϯϭϴϰ Ϯϱϰϭ͘ϵϵ ϲϮ͘ϯϬϲϯϭ Ϭ͘ϬϮϭϳϯϴ Ϯ͘ϰϰϱϳϵϵ Ϭ͘Ϭϴϵϳϲϱ Ϭ͘Ϭϰϭϳϯϭ Ϭ͘ϬϴϰϬϭϳ Ϭ͘Ϭϱϲϱϴ Ϭ͘ϭϬϲϰϱϲ ϭϬ͘ϱϵϰϭϯ Ϭ͘ϱϮϭϭϯϮ Ϭ͘ϭϯϵϭϮϭ Ϭ͘ϰϬϲϴϲϰ Ϯ͘Ϭϵϰϱϲϲ Ϭ͘ϭϱϱϯϰ ϭϱ͘ϰϱϴϵϯ Ϭ͘ϱϳϬϱϳϰ Ϭ͘ϭϯϵϭϮϭ Ϭ͘ϰϬϲϴϲϰ Ϯ͘Ϭϵϰϱϲϲ Ϭ͘Ϭϰϱ Ϯ͘ϳϬϳϭϴϭ ϴϭ͘ϵϱϯϭϮ ϭϯ͘Ϯϴϯϱ Ϭ͘ϬϬϳϴϴϮ Ϭ͘ϬϮϱϭϯ Ϭ͘ϬϬϬϲϭϲ^ĂŶDĂƚĞŽ ϮϬϮϯ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϲϴ͘ϴϭϭϴ ϯϳϵϯ͘Ϭϰϭ ϯϳϵϯ͘Ϭϰϭ Ϭ Ϯϰϰϰ͘ϯϵϱ ϱ͘ϬϬϯϭϰ Ϯϯ͘ϴϳϭϳϮ Ϭ͘ϰϯϳϱϴϳ Ϭ͘ϬϮϯϵϱϯ Ϭ͘ϬϮϱϴϭϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϮϱϬϯϲ Ϭ͘ϬϮϲϵϴϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϭϰϵ͘ϳϯϴ ϮϮϰϲ͘ϴϱϯ Ϭ Ϭ͘ϬϬϯϮϯϯ Ϭ͘ϬϬϴϯϭϮ Ϭ Ϭ͘ϭϴϭϭϰϮ Ϭ͘ϯϱϯϵϵϯ Ϭ Ϭ͘Ϭϲϵϲϭϱ Ϭ͘ϭϳϴϵϲϰϬϬϬϬϬ͘ϬϳϵϮϱϮ Ϭ͘ϮϬϯϳϯϳϬϬϬϬϬ͘ϭϯϰϬϭϵ Ϭ͘ϮϬϴϱϵϰ ϰ͘Ϯϴϵϲϭϲ Ϭ Ϭ͘ϬϭϬϴϴϳ Ϭ͘ϬϮϭϮϳϲ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϭ͘Ϭϰϭϰϳϱ Ϭ͘ϰϴϭϭϯϭ ϬϬ͘ϰϴϭϭϯϭ Ϭ͘ϲϬϬϱϲϰϬϬϬϬϬϬϬ͘ϬϬϯϬ͘ϬϬϳϴϲ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϰϱϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲ͘ϬϮϯϬϯϲ ϭϱϯ͘ϰϬϰϭ ϭϱϯ͘ϰϬϰϭ Ϭ ϴϳ͘Ϯϭϯϱϲ Ϭ͘ϱϱϲϯϯϮ ϱ͘ϮϲϰϮϲϭ Ϭ Ϭ͘ϬϬϯϯϳϴ Ϭ͘Ϭϭϭϱϭϲ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϯϲϳϰ Ϭ͘ϬϭϮϱϮϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϮϱϴ͘Ϭϯϲ ϰϬϴϬ͘ϰϮ Ϭ ϯ͘ϰϬϴϱϴϯ ϭϱ͘ϭϳϰϳϰ Ϭ Ϭ͘Ϯϱϲϰϱϵ Ϭ͘ϴϯϭϴϮ Ϭ Ϭ͘ϬϰϴϳϬϮ Ϭ͘ϮϭϲϴϭϳϬϬϬϬϯ͘ϰϳϴϳϬϵ ϭϱ͘ϰϴϲϵϰϬϬϬϬϭ͘Ϭϲϭϭ͘ϱϭϲϴϮ Ϯϭ͘ϭϬϯϳϭ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϭ͘ϮϲϮϳϴ ϰϭϲϱ͘ϲϳϲ ϰϭϲϱ͘ϲϳϲ Ϭ Ϯϰϱ͘Ϭϱϭϭ Ϭ͘ϬϯϳϬϭϳ Ϭ Ϭ͘ϱϳϴϮϯϯ Ϭ͘ϬϬϬϵϴϵ Ϭ Ϭ͘ϬϬϬϭϮϳ Ϭ͘ϬϬϮϬϳϯ Ϭ͘ϬϯϮϯϯϯϬ͘ϬϬϭϬϳϲ Ϭ Ϭ͘ϬϬϬϭϯϵ Ϭ͘ϬϬϴϮϵ Ϭ͘ϬϵϮϯϳϵ ϭϬϮϱ͘ϲϴϮ Ϭ ϰϭ͘Ϯϯϴϲϴ Ϭ͘ϬϬϮϮϱϵ Ϭ Ϭ͘Ϭϱϯϱϲϱ Ϭ͘ϬϬϰϵϱϲ Ϭ Ϭ͘ϬϳϳϬϯϵ Ϭ͘ϬϬϲϲϯϭ Ϭ Ϭ͘ϮϬϲϮϴϭ Ϭ͘ϬϳϬϱϴϵ Ϭ͘ϭϭϰϱϱϱ Ϭ͘ϲϵϯϲϱϯ Ϭ͘ϬϬϵϲϳϳ Ϭ Ϭ͘ϮϮϱϴϱϮ Ϭ͘ϬϳϬϱϴϵ Ϭ͘ϭϭϰϱϱϱ Ϭ͘ϲϵϯϲϱϯ Ϭ͘Ϭϰϱ Ϭ͘ϱϱϲϭϱϰ Ϭ ϱ͘ϴϴϳϱϰϭ Ϭ͘ϬϭϬϭϰ Ϭ Ϭ͘ϬϬϬϰϬϴ^ĂŶDĂƚĞŽ ϮϬϮϯ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϯϰϭ͘ϴϰϲϯ ϮϴϱϰϬ͘ϲϮ ϮϴϱϰϬ͘ϲϮ Ϭ ϭϯϲϳ͘ϯϴϱ Ϯ͘ϴϵϳϱϵϯ Ϭ Ϭ Ϭ͘ϬϬϳϲϭϵ Ϭ Ϭ Ϭ͘ϬϬϳϵϭϯ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϳϵϲϰ Ϭ Ϭ Ϭ͘ϬϯϭϲϱϮϬ͘ϭϭ ϭϰϱϭ͘ϰϱϯ Ϭ Ϭ Ϭ͘ϬϬϳϯϭϭ Ϭ Ϭ Ϭ͘ϮϮϴϲϳϳ Ϭ Ϭ Ϭ͘ϭϱϳϯϵϱϬϬϬϬϬϬ͘ϭϳϵϭϴϮ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϮϮϲϰϰ Ϭ͘ϭϵϮϵϴϵ Ϭ Ϭ Ϭ͘Ϭϭϯϳϱϯ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϯ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯ͘ϬϭϴϳϬϯ ϭϱ͘ϯϭϵϯ Ϭ ϭϱ͘ϯϭϵϯ ϴ͘ϬϳϰϴϭϭϬϬϬϬϬϬϬ͘ϬϬϵϬ͘ϬϭϵϮϱ Ϭ Ϭ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϬϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϯ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϯϰ͘ϵϰϯϭϵ ϭϭϵϵ͘ϲϭϭ ϭϭϵϵ͘ϲϭϭ Ϭ ϭϯϵ͘ϳϳϮϴ Ϭ͘ϬϲϯϰϬϱ Ϭ Ϭ Ϭ͘ϬϬϬϮϵϲ Ϭ Ϭ Ϭ͘ϬϬϴϳϴϵ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϬϯϬϵ Ϭ Ϭ Ϭ͘Ϭϯϱϭϱϳ Ϭ͘ϭϭ ϭϯϰϵ͘ϯϴ Ϭ Ϭ ϰ͘ϰϰϱϴϯϭ Ϭ Ϭ Ϭ͘ϮϳϱϬϴ Ϭ Ϭ Ϭ͘ϬϲϯϱϮϮϬϬϬϬϬϰ͘ϱϯϳϮϵϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϵϳ ϱϮ͘ϱϯϲϳϭ Ϭ Ϭ Ϭ Ϭ Ϭ ^ŽƵƌĐĞ͗D&ϮϬϮϭ;ǀϭ͘Ϭ͘ϮͿŵŝƐƐŝŽŶZĂƚĞƐZĞŐŝŽŶdǇƉĞ͗ŽƵŶƚǇZĞŐŝŽŶ͗^ĂŶDĂƚĞŽĂůĞŶĚĂƌzĞĂƌ͗ϮϬϮϰ^ĞĂƐŽŶ͗ŶŶƵĂůsĞŚŝĐůĞůĂƐƐŝĨŝĐĂƚŝŽŶ͗D&ϮϬϬϳĂƚĞŐŽƌŝĞƐhŶŝƚƐ͗ŵŝůĞƐͬĚĂǇĨŽƌsDdĂŶĚsDd͕ƚƌŝƉƐͬĚĂǇĨŽƌdƌŝƉƐ͕ŐͬŵŝůĞĨŽƌZhEy͕WDtĂŶĚWDdt͕ŐͬƚƌŝƉĨŽƌ^dZy͕,Kd^K<ĂŶĚZhE>K^^͕ŐͬǀĞŚŝĐůĞͬĚĂǇĨŽƌ/>yĂŶĚ/hZE͘W,sĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŽƚĂůsDd͘ZĞŐŝŽŶ ĂůĞŶĚĂƌz sĞŚŝĐůĞĂƚDŽĚĞůzĞĂ ^ƉĞĞĚ &ƵĞů WŽƉƵůĂƚŝŽŶdŽƚĂůsDd sDd sDd dƌŝƉƐ EKǆͺZhEEKǆͺ/>yEKǆͺ^dZyWDϮ͘ϱͺZh WDϮ͘ϱͺ/>WDϮ͘ϱͺ^dZWDϮ͘ϱͺWDWDϮ͘ϱͺWDWDϭϬͺZhEWDϭϬͺ/>WDϭϬͺ^dZ WDϭϬͺWDdWDϭϬͺWDKϮͺZhEKϮͺ/>yKϮͺ^dZy,ϰͺZhE,ϰͺ/>y,ϰͺ^dZyEϮKͺZhEEϮKͺ/>yEϮKͺ^dZyZK'ͺZhEZK'ͺ/>yZK'ͺ^dZyZK'ͺ,Kd^ZK'ͺZhE>ZK'ͺ/hZdK'ͺZhEdK'ͺ/>ydK'ͺ^dZydK'ͺ,Kd^dK'ͺZhE>dK'ͺ/hZ E,ϯͺZhEKͺZhEyKͺ/>y Kͺ^dZy ^KǆͺZhE ^Kǆͺ/>y ^Kǆͺ^dZy^ĂŶDĂƚĞŽ ϮϬϮϰ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϰ͘ϯϴϰϭϭ ϱϳϬ͘ϭϱϭϵ ϱϳϬ͘ϭϱϭϵ Ϭ ϴϳ͘ϳϭϳϮϳ ϰ͘Ϭϰϴϭϴϴ Ϭ Ϭ͘ϬϬϮϭϵϱ Ϭ͘ϬϬϭϰϭϮ Ϭ Ϭ͘ϬϬϬϳϴϭ Ϭ͘ϬϬϱ Ϭ͘ϬϯϭϬϴϳ Ϭ͘ϬϬϭϱϯϲ Ϭ Ϭ͘ϬϬϬϴϰϵ Ϭ͘ϬϮ Ϭ͘ϬϴϴϴϮ ϮϮϰϮ͘ϲϭϲ Ϭ ϱϮ͘ϱϭϴϭϯ Ϭ͘ϭϭϰϵϮϳ Ϭ ϵ͘ϴϯͲϬϱ Ϭ͘ϭϱϭϰϬϵ Ϭ Ϭ͘ϬϬϬϭϬϲ Ϭ͘ϱϴϬϬϭϭ Ϭ Ϭ͘ϬϬϬϱϯϰ Ϭ͘Ϭϯϴϭϲϰ Ϭ͘Ϯϵϴϰϰϭ Ϯ͘ϲϮϭϭϰϲ Ϭ͘ϴϰϲϯϱ Ϭ Ϭ͘ϬϬϬϱϴϰ Ϭ͘Ϭϯϴϭϲϰ Ϭ͘Ϯϵϴϰϰϭ Ϯ͘ϲϮϭϭϰϲ Ϭ͘Ϭϰϱ ϯϯ͘ϳϲϱϵϱ Ϭ ϱ͘ϬϲϰϭϬϲ Ϭ͘ϬϮϮϭϳϭ Ϭ Ϭ͘ϬϬϬϱϭϵ^ĂŶDĂƚĞŽ ϮϬϮϰ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϯϭϰ͘ϲϮϱ ϭϭϵϰϴϵ͘ϭ ϭϭϵϰϴϵ͘ϭ Ϭ ϭϰϯϱϵ͘ϰϲ Ϯ͘ϳϱϴϱϮϯ ϰϲ͘ϯϲϭϵϯ Ϯ͘ϵϰϴϮϱϵ Ϭ͘ϬϮϱϬϭϲ Ϭ͘ϬϯϱϮϳϯ Ϭ Ϭ͘ϬϬϴϲϬϳ Ϭ͘ϬϯϬϲϲϲ Ϭ͘ϬϮϲϭϰϳ Ϭ͘Ϭϯϲϴϲϴ Ϭ Ϭ͘ϬϯϰϰϮϵ Ϭ͘Ϭϴϳϲϭϲ ϭϴϭϱ͘ϴϳϰ ϴϮϭϴ͘ϴϰ Ϭ Ϭ͘ϬϬϭϮϲϰ Ϭ͘ϭϱϳϮϰϯ Ϭ Ϭ͘ϮϴϲϬϵϮ ϭ͘ϮϵϰϴϴϮ Ϭ Ϭ͘ϬϮϳϮϬϱ ϯ͘ϯϴϱϰϬϰϬϬϬϬϬ͘ϬϯϬϵϳϭ ϯ͘ϴϱϰϬϮϰϬϬϬϬϬ͘ϭϵϵϯϵ Ϭ͘ϭϭϴϰϮϱ ϰϳ͘ϭϵϵϳϴ Ϭ Ϭ͘Ϭϭϳϭϵϱ Ϭ͘ϬϳϳϴϮϴ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϰ͘ϮϮϯϬϱ ϯϲϰ͘Ϯϴϳϵ Ϭ ϯϲϰ͘Ϯϴϳϵ ϰϭ͘ϴϯϰϮ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴϱϴϮ Ϭ͘ϬϭϲϴϮϵ Ϭ Ϭ Ϭ Ϭ͘ϬϯϰϯϮϵ Ϭ͘ϬϰϴϬϴϮϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϲϴ͘ϱϰϵϱ ϭϭϭϴϳ͘ϴϯ ϭϭϭϴϳ͘ϴϯ Ϭ ϭϭϯϮ͘ϭϳϱ ϭ͘ϰϵϮϱϱϮ ϵ͘ϱϮϬϵϮϳ Ϭ Ϭ͘ϬϬϭϳϴϴ Ϭ͘ϬϭϮϮϰϯ Ϭ Ϭ͘ϬϬϵ Ϭ͘Ϭϱϵϯϯϲ Ϭ͘ϬϬϭϵϰϰ Ϭ͘Ϭϭϯϯϭϱ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϭϲϵϱϯϯ ϭϰϵϴ͘ϵϱϯ ϴϰϬϳ͘ϲϰϱ Ϭ ϯ͘Ϭϴϭϴϳϰ Ϯϰ͘ϭϯϴϳϰ ϬϬ͘ϯϬϱϱϳϭ ϭ͘ϳϭϯϵϱϯ Ϭ Ϭ͘ϬϲϵϬϲϮ Ϭ͘ϯϴϵϱϰϰϬϬϬϬϯ͘ϭϳϯϳϵϰ Ϯϰ͘ϲϴϲϮϮ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϳϮϵϭϮϱ ϭϲ͘ϲϱϵϲϮ ϲϰ͘ϴϰϯϵϴ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϯϵϰϭϵ͘ϳ ϳϰϱϰϬϬϬ ϳϰϱϰϬϬϬ Ϭ ϭϭϮϰϮϳϭ Ϭ͘ϬϯϴϬϴϳ Ϭ Ϭ͘Ϯϰϳϴϰϭ Ϭ͘ϬϬϭϭϲϮ Ϭ Ϭ͘ϬϬϭϵϲϰ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϰϴ Ϭ͘ϬϬϭϮϲϯ Ϭ Ϭ͘ϬϬϮϭϯϲ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϳϬϵ ϮϳϬ͘ϵϴϭϯ Ϭ ϲϴ͘ϴϴϬϵϲ Ϭ͘ϬϬϮϬϯϴ Ϭ Ϭ͘Ϭϲϴϭϲϵ Ϭ͘ϬϬϰϮϯϲ Ϭ Ϭ͘ϬϯϭϯϬϵ Ϭ͘ϬϬϳϴϰϳ Ϭ Ϭ͘ϯϭϴϯϭϯ Ϭ͘Ϭϴϯϯϳϳ Ϭ͘Ϯϭϯϯϯϴ ϭ͘ϮϳϳϱϬϮ Ϭ͘Ϭϭϭϰϱ Ϭ Ϭ͘ϯϰϴϱϭϮ Ϭ͘Ϭϴϯϯϳϳ Ϭ͘Ϯϭϯϯϯϴ ϭ͘ϮϳϳϱϬϮ Ϭ͘Ϭϯϲϭϳϲ Ϭ͘ϲϯϳϳϳϱ Ϭ ϯ͘ϭϵϵϳϳϴ Ϭ͘ϬϬϮϲϳϵ ϬϬ͘ϬϬϬϲϴϭ^ĂŶDĂƚĞŽ ϮϬϮϰ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϳϳϬ͘ϰϰϯ ϭϳϱϱϳ͘Ϭϯ ϭϳϱϱϳ͘ϬϯϬ ϯϮϰϳ͘ϭϯϴ Ϭ͘ϭϴϴϱϵϯ Ϭ Ϭ Ϭ͘ϬϭϮϳϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϰϬϰ Ϭ͘ϬϭϯϮϴϱ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϴϲϵ ϮϯϮ͘ϮϮϳϭ Ϭ Ϭ Ϭ͘ϬϬϭϬϱϰ Ϭ Ϭ Ϭ͘Ϭϯϲϱϴϳ Ϭ Ϭ Ϭ͘ϬϮϮϲϵϲϬϬϬϬϬϬ͘ϬϮϱϴϯϴ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϯϬϰϭϰϰ Ϭ Ϭ Ϭ͘ϬϬϮϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϳϵϯϰ͘ϴϲ ϲϴϵϯϵϮ͘ϭ Ϭ ϲϴϵϯϵϮ͘ϭ ϴϵϬϳϮ͘Ϭϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϯ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϭϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϳϱϬϬ͘ϵϯϲ ϮϳϱϮϯϭ͘ϭ ϭϯϯϴϱϳ͘ϰ ϭϰϭϯϳϯ͘ϳ ϯϭϬϭϲ͘ϯϳ Ϭ͘ϬϬϯϭϮϱ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϱϳϳ Ϭ Ϭ͘ϬϬϭϵϴϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϮϰ Ϭ͘ϬϬϬϲϮϴ Ϭ Ϭ͘ϬϬϮϭϲϮ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϳϴϯ ϭϯϭ͘Ϯϱϰϳ Ϭϲϰ͘Ϯϭϰϭϰ Ϭ͘ϬϬϬϰϬϮ Ϭ Ϭ͘ϬϰϮϭϭϳ Ϭ͘ϬϬϬϱϯϰ Ϭ Ϭ͘ϬϮϬϬϮϵ Ϭ͘ϬϬϭϯϭϯ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘Ϭϯϳϲϯϱ Ϭ͘Ϭϯϯϳϵ Ϭ͘ϯϵϯϲϲϱ Ϭ͘ϬϬϭϵϭϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘Ϭϯϳϲϯϱ Ϭ͘Ϭϯϯϳϵ Ϭ͘ϯϵϯϲϲϱ Ϭ͘Ϭϭϵϰ Ϭ͘ϭϵϲϬϱϱ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϵϴ Ϭ Ϭ͘ϬϬϬϲϯϱ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϮϱϬϭϬ͘Ϭϱ ϳϮϴϳϬϴ͘ϲ ϳϮϴϳϬϴ͘ϲ Ϭ ϭϭϰϮϯϬ͘ϭ Ϭ͘ϭϬϭϭϳϱ Ϭ Ϭ͘ϯϯϳϳϲϲ Ϭ͘ϬϬϭϱϯϭ Ϭ Ϭ͘ϬϬϮϰϯϯ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϮϯ Ϭ͘ϬϬϭϲϲϱ Ϭ Ϭ͘ϬϬϮϲϰϳ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϲϲ ϯϭϳ͘ϱϰϴϲ Ϭ ϴϯ͘Ϭϲϭϱϵ Ϭ͘ϬϬϰϳϰϭ Ϭ Ϭ͘ϬϵϭϱϬϵ Ϭ͘ϬϬϳϲϯϱ Ϭ Ϭ͘Ϭϯϱϰϰϳ Ϭ͘ϬϮϬϵϰϯ Ϭ Ϭ͘ϰϲϰϵϮϵ Ϭ͘ϭϯϯϵϯ Ϭ͘ϯϳϴϱϳϭ Ϯ͘ϭϭϵϰϯϱ Ϭ͘ϬϯϬϱϱϳϬ Ϭ͘ϱϬϵϬϯϴ Ϭ͘ϭϯϯϵϯ Ϭ͘ϯϳϴϱϳϭ Ϯ͘ϭϭϵϰϯϱ Ϭ͘Ϭϯϳϱϭ ϭ͘ϬϵϴϬϴϯ Ϭ ϰ͘ϲϰϮϰϰϯ Ϭ͘ϬϬϯϭϯϵ Ϭ Ϭ͘ϬϬϬϴϮϭ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲ͘ϵϬϳϲϳϰ ϴϳ͘ϱϬϱϵϳ ϴϳ͘ϱϬϱϵϳ Ϭ ϭϵ͘ϲϵϴϲϴ ϭ͘ϲϱϲϬϯϱ Ϭ Ϭ Ϭ͘Ϯϯϲϰϵϯ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϯϯϮϯ Ϭ͘Ϯϰϳϭϴϲ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϰϵϱ ϰϭϳ͘ϰϬϱϯ Ϭ Ϭ Ϭ͘Ϭϭϰϱϲϰ Ϭ Ϭ Ϭ͘ϬϲϱϳϲϮ Ϭ Ϭ Ϭ͘ϯϭϯϱϱϵϬϬϬϬϬϬ͘ϯϱϲϵϲϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ ϭ͘ϲϲϴϭϯϮ Ϭ Ϭ Ϭ͘ϬϬϯϵϱϱ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϵϭ͘ϱϵϲϱϰ ϯϮϳϴ͘ϭϯϭ ϬϯϮϳϴ͘ϭϯϭ ϰϰϯ͘ϱϰϰϮϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϯ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϴϭϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϱϰ͘ϮϱϬϲϵ Ϯϭϳϰ͘ϴϵϯ ϵϳϭ͘ϮϵϬϳ ϭϮϬϯ͘ϲϬϮ ϮϮϰ͘ϯϮϲϲ Ϭ͘ϬϬϮϴϲϵ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϲϰ Ϭ Ϭ͘ϬϬϭϯϳϲ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯϴ Ϭ͘ϬϬϬϯϵϲ Ϭ Ϭ͘ϬϬϭϰϵϲ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϮϯ ϭϮϬ͘ϱϰϲϰ Ϭϲϵ͘ϯϱϱϭϰ Ϭ͘ϬϬϬϯϳ Ϭ Ϭ͘ϬϰϮϭϰϮ Ϭ͘ϬϬϬϰϵϭ Ϭ Ϭ͘ϬϮϬϬϱϮ Ϭ͘ϬϬϭϮϬϲ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϰϬϬϯ Ϭ͘ϬϮϬϴϬϵ Ϭ͘ϮϲϵϰϬϴ Ϭ͘ϬϬϭϳϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϰϬϬϯ Ϭ͘ϬϮϬϴϬϵ Ϭ͘ϮϲϵϰϬϴ Ϭ͘Ϭϭϴϳϱϳ Ϭ͘ϭϴϬϭϯϭ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϵϮ Ϭ Ϭ͘ϬϬϬϲϴϲ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϰϵϱϯϲ ϰϵϭϰϵϬϭ ϰϵϭϰϵϬϭϬ ϳϭϴϬϯϱ͘ϲ Ϭ͘Ϭϰϳϴϯϳ Ϭ Ϭ͘Ϯϳϱϲϯϳ Ϭ͘ϬϬϭϭϱϱ Ϭ Ϭ͘ϬϬϭϴϴϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϭϵ Ϭ͘ϬϬϭϮϱϲ Ϭ Ϭ͘ϬϬϮϬϰϲ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϳϲϴ ϯϮϲ͘ϰϬϮϯ Ϭ ϴϮ͘ϵϬϮϰϮ Ϭ͘ϬϬϮϭϱϰ Ϭ Ϭ͘ϬϳϬϴϱϵ Ϭ͘ϬϬϰϲϭϯ Ϭ Ϭ͘ϬϯϯϮϯ Ϭ͘ϬϬϴϭϱϵ Ϭ Ϭ͘ϯϮϭϵϬϯ Ϭ͘Ϭϱϵϰϱϳ Ϭ͘ϭϱϭϬϵϴ Ϭ͘ϵϱϬϴϭϱ Ϭ͘ϬϭϭϵϬϲ Ϭ Ϭ͘ϯϱϮϰϰϯ Ϭ͘Ϭϱϵϰϱϳ Ϭ͘ϭϱϭϬϵϴ Ϭ͘ϵϱϬϴϭϱ Ϭ͘Ϭϯϴϰϳϵ Ϭ͘ϲϱϬϴϮ Ϭ ϯ͘Ϯϲϱϭϳϭ Ϭ͘ϬϬϯϮϮϳ Ϭ Ϭ͘ϬϬϬϴϮ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϱϴϮ͘ϭϳϰϴ ϭϴϵϱϰ͘ϬϮ ϭϴϵϱϰ͘ϬϮ Ϭ Ϯϳϵϴ͘Ϯϯϯ Ϭ͘ϬϯϵϲϬϮ Ϭ Ϭ Ϭ͘ϬϬϰϱϮϱ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϰϮ Ϭ͘ϬϬϰϳϯ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϯϱ ϯϬϯ͘ϯϯϲϳ Ϭ Ϭ Ϭ͘ϬϬϬϱϴϯ Ϭ Ϭ Ϭ͘Ϭϰϳϳϵϭ Ϭ Ϭ Ϭ͘ϬϭϮϱϰϵϬϬϬϬϬϬ͘ϬϭϰϮϴϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϭϵϯϱϲ Ϭ Ϭ Ϭ͘ϬϬϮϴϳϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϮϱϬ͘ϵϱϳ ϯϳϱϵϴ͘ϴϵ Ϭϯϳϱϵϴ͘ϴϵ ϲϯϵϰ͘ϮϰϱϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϱϴϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϭϲϯϭ͘ϯϵϭ ϲϮϳϮϰ͘ϴϱ ϮϵϮϬϯ͘ϱ ϯϯϱϮϭ͘ϯϱ ϲϳϰϱ͘ϴϬϯ Ϭ͘ϬϬϮϵϵϭ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϰϱ Ϭ Ϭ͘ϬϬϭϲϭϯ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯϭ Ϭ͘ϬϬϬϰϴϰ Ϭ Ϭ͘ϬϬϭϳϱϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϬϯ ϭϮϱ͘ϲϲϰϭ Ϭ ϳϱ͘ϯϯϬϯϱ Ϭ͘ϬϬϬϯϴϱ Ϭ Ϭ͘ϬϰϮϭϰϭ Ϭ͘ϬϬϬϱϭϮ Ϭ Ϭ͘ϬϮϬϬϱϭ Ϭ͘ϬϬϭϮϱϳ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϱϮϴϵ Ϭ͘ϬϮϯϬϲϭ Ϭ͘Ϯϵϭϳϭϰ Ϭ͘ϬϬϭϴϯϰ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϱϮϴϵ Ϭ͘ϬϮϯϬϲϭ Ϭ͘Ϯϵϭϳϭϰ Ϭ͘Ϭϭϵϱϯϴ Ϭ͘ϭϴϳϳϱϭ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϰϮ Ϭ Ϭ͘ϬϬϬϳϰϱ^ĂŶDĂƚĞŽ ϮϬϮϰ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϭϭϭϬ͘Ϯϵ ϰϬϭϮϱϴ͘ϰ ϰϬϭϮϱϴ͘ϰ Ϭ ϭϲϱϱϮϲ͘ϴ Ϭ͘ϭϬϴϬϱϰ Ϭ͘Ϭϯϯϳϴϵ Ϭ͘ϱϳϭϭϭϳ Ϭ͘ϬϬϭϯϴϭ Ϭ Ϭ͘ϬϬϬϮϯϭ Ϭ͘ϬϬϮ Ϭ͘ϬϮϳϯ Ϭ͘ϬϬϭϱϬϮ Ϭ Ϭ͘ϬϬϬϮϱϮ Ϭ͘ϬϬϴ Ϭ͘Ϭϳϴ ϴϯϲ͘ϴϳϲϲ ϭϭϲ͘ϱϲϰϵ Ϯϲ͘ϳϯϲϮϵ Ϭ͘ϬϬϱϱϱϳ Ϭ͘ϭϬϳϱϬϲ Ϭ͘ϬϮϴϳϰϱ Ϭ͘ϬϬϲϭϵϳ Ϭ͘ϬϬϮϵϮ Ϭ͘ϬϰϴϮϵϮ Ϭ͘ϬϮϳϬϯ Ϭ͘ϯϴϳϯϵϰ Ϭ͘ϭϯϵϰϯϳ Ϭ͘Ϭϯϯϵϲϴ Ϭ͘ϭϴϰϴϴ ϭ͘ϴϳϯϬϳϴ Ϭ͘Ϭϯϵϰϰϯ Ϭ͘ϱϲϱϮϴϰ Ϭ͘ϭϱϮϲϲϲ Ϭ͘Ϭϯϯϵϲϴ Ϭ͘ϭϴϰϴϴ ϭ͘ϴϳϯϬϳϴ Ϭ͘Ϭϰϰϵϰϵ Ϭ͘ϵϯϮϰϯϰ ϯ͘ϳϲϯϵϲϳ ϯ͘ϯϰϱϰϳϱ Ϭ͘ϬϬϴϮϳϯ Ϭ͘ϬϬϭϭϱϮ Ϭ͘ϬϬϬϮϲϰ^ĂŶDĂƚĞŽ ϮϬϮϰ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϵϵϲ͘ϲϵϮ ϭϵϭϱϱϭ͘ϰ ϭϵϭϱϱϭ͘ϰ Ϭ ϲϮϴϱϮ͘Ϭϵ ϭ͘ϬϮϳϱϱϭ ϭ͘ϲϮϴϬϱϱ Ϭ Ϭ͘ϬϮϰϰϲϵ Ϭ͘ϬϮϲϳϴϰ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϮϳϯ Ϭ͘ϬϮϱϱϳϱ Ϭ͘ϬϮϳϵϵϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϳϴ ϲϮϱ͘ϭϴϱϴ ϭϮϲ͘ϴϭϱϵ Ϭ Ϭ͘ϬϬϲϭϰϮ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϬϵϴϰϵϴϬ͘Ϭϭϵϵϴ Ϭ Ϭ͘ϭϯϮϮϮϳ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϱϬϱϯϮ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϵϭϬϯϵ Ϭ͘ϯϯϭϱϭϱ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϱϵϮϰ Ϭ͘ϬϬϭϮϬϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϱϲ͘ϴϴϱϱϮ ϯϱϯϬ͘ϲϰϮϬ ϯϱϯϬ͘ϲϰϮ ϳϵϰ͘ϲϱϰϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘Ϭϭϯϲϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϯϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϮϴϵ͘ϯϴϱ ϰϰϱϱϭ͘ϳϲ ϰϰϱϱϭ͘ϳϲ Ϭ ϭϵϮϬϵ͘ϵϮ Ϭ͘ϭϮϮϮϮϴ Ϭ͘ϬϯϮϴϬϮ Ϭ͘ϱϳϰϯϯϯ Ϭ͘ϬϬϭϯϭϳ Ϭ Ϭ͘ϬϬϬϮϬϯ Ϭ͘ϬϬϮ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϬϭϰϯϮ Ϭ Ϭ͘ϬϬϬϮϮ Ϭ͘ϬϬϴ Ϭ͘Ϭϵϭ ϵϰϰ͘ϱϰϭϳ ϭϯϱ͘Ϭϲϲϳ Ϯϱ͘ϯϭϲϵϲ Ϭ͘ϬϬϰϳϳϱ Ϭ͘ϭϬϯϱϭ Ϭ͘ϬϮϴϯϳϯ Ϭ͘ϬϬϳϯϳϭ Ϭ͘ϬϬϮϳϯϱ Ϭ͘ϬϰϲϲϬϲ Ϭ͘ϬϮϭϴϱ Ϭ͘ϯϳϲϭϲϲ Ϭ͘ϭϯϴϰϱϳ Ϭ͘ϬϯϱϰϬϯ Ϭ͘ϭϴϵϯϰϱ ϭ͘ϵϰϴϱϵϰ Ϭ͘Ϭϯϭϴϴϯ Ϭ͘ϱϰϴϵ Ϭ͘ϭϱϭϱϵϯ Ϭ͘ϬϯϱϰϬϯ Ϭ͘ϭϴϵϯϰϱ ϭ͘ϵϰϴϱϵϰ Ϭ͘Ϭϰϰϵϵ Ϭ͘ϴϭϰϭϳ ϯ͘ϳϲϲϬϬϮ ϯ͘ϯϭϯϮϮϮ Ϭ͘ϬϬϵϯϯϴ Ϭ͘ϬϬϭϯϯϱ Ϭ͘ϬϬϬϮϱ^ĂŶDĂƚĞŽ ϮϬϮϰ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϭϳϯ͘ϲϲϮ ϴϯϳϯϮ͘ϰϰ ϴϯϳϯϮ͘ϰϰ Ϭ Ϯϳϯϰϭ͘ϵϯ Ϭ͘ϳϱϴϴϭϳ ϭ͘ϱϱϮϱϵϯ Ϭ Ϭ͘ϬϮϭϵϬϱ Ϭ͘ϬϮϲϴϭϯ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϮϮϴϵϲ Ϭ͘ϬϮϴϬϮϲ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϵϭ ϳϯϴ͘ϴϵϯ ϮϬϭ͘ϳϳϴϴ Ϭ Ϭ͘ϬϬϱϳϱ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϭϲϰϭϯ Ϭ͘Ϭϯϭϳϵ Ϭ Ϭ͘ϭϮϯϳϵϰ Ϭ͘ϭϬϵϳϲ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϰϬϵϯϭ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϬϱϴϳ Ϭ͘ϮϴϬϴϲϯ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϳϬϬϭ Ϭ͘ϬϬϭϵϭϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϰ͘ϳϮϯϳϱ ϴϲϱ͘ϴϯϴϯϬ ϴϲϱ͘ϴϯϴϯ ϭϵϰ͘ϴϵϳϵ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϰϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ Dz ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϯϮϲϯ͘ϴϵ ϳϲϲϳϱ͘ϯϳ ϳϲϲϳϱ͘ϯϳ Ϭ ϮϲϱϮϳ͘ϳϴ Ϭ͘ϱϭϴϳϵϯ Ϭ Ϭ͘ϭϮϲϭϱϮ Ϭ͘ϬϬϭϴϴϭ Ϭ Ϭ͘ϬϬϯϰϴϮ Ϭ͘ϬϬϭ Ϭ͘ϬϬϰϮ Ϭ͘ϬϬϮϬϭϮ Ϭ Ϭ͘ϬϬϯϳϬϴ Ϭ͘ϬϬϰ Ϭ͘ϬϭϮ ϭϴϲ͘ϵϮϱϲ Ϭ ϰϲ͘Ϭϵϰϲϭ Ϭ͘ϭϰϱϭϲϴ Ϭ Ϭ͘ϭϳϯϬϳϴ Ϭ͘ϬϯϲϵϲϵϬ Ϭ͘ϬϬϳϱϰϵ Ϭ͘ϵϯϬϯϲϱ Ϭ ϭ͘ϮϳϱϮϬϴ ϯ͘ϱϱϭϯϱϯ ϯ͘ϳϬϴϳϮ ϯ͘Ϯϴϯϲϰ ϭ͘ϭϮϱϭϮϳ Ϭ ϭ͘ϯϴϲϱϮϰ ϯ͘ϱϱϭϯϱϯ ϯ͘ϳϬϴϳϮ ϯ͘Ϯϴϯϲϰ Ϭ͘ϬϬϴϵϬϭ ϭϭ͘Ϭϰϲϭ Ϭ ϳ͘ϳϱϬϬϳϲ Ϭ͘ϬϬϭϴϰϴ Ϭ Ϭ͘ϬϬϬϰϱϲ^ĂŶDĂƚĞŽ ϮϬϮϰ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϰϭϳϯ͘ϭϵ ϮϴϮϯϭϴϯ ϮϴϮϯϭϴϯ Ϭ ϰϬϮϰϰϭ͘ϲ Ϭ͘Ϭϱϴϰϯϰ Ϭ Ϭ͘ϯϮϴϱϵϭ Ϭ͘ϬϬϭϭϱϲ Ϭ Ϭ͘ϬϬϭϵϱϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϯϳ Ϭ͘ϬϬϭϮϱϴ Ϭ Ϭ͘ϬϬϮϭϮϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϭϵ ϯϵϯ͘ϱϳϰϯ Ϭ ϭϬϬ͘ϰϰϳϯ Ϭ͘ϬϬϮϰϵϮ Ϭ Ϭ͘Ϭϴϭϰϭ Ϭ͘ϬϬϱϭϲϭ Ϭ Ϭ͘Ϭϯϱϯϴϲ Ϭ͘ϬϬϵϵϰϭ Ϭ Ϭ͘ϯϵϯϲϱϲ Ϭ͘ϬϲϲϵϬϰ Ϭ͘ϭϴϬϵϳϱ ϭ͘ϭϭϱϮϳϳ Ϭ͘ϬϭϰϱϬϭ Ϭ Ϭ͘ϰϯϭϬϬϯ Ϭ͘ϬϲϲϵϬϰ Ϭ͘ϭϴϬϵϳϱ ϭ͘ϭϭϱϮϳϳ Ϭ͘Ϭϯϴϳϰϲ Ϭ͘ϲϴϲϭϳϴ Ϭ ϯ͘ϰϱϴϳϯ Ϭ͘ϬϬϯϴϵϭ ϬϬ͘ϬϬϬϵϵϯ^ĂŶDĂƚĞŽ ϮϬϮϰ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϭϲϯ͘ϲϲϳ ϯϴϭϱϳ͘ϱ ϯϴϭϱϳ͘ϱ ϬϱϱϱϮ͘ϭ Ϭ͘ϬϯϳϮϲϭ Ϭ Ϭ Ϭ͘ϬϬϰϬϬϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϵϴ Ϭ͘ϬϬϰϭϴϮ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϵϵϱ ϯϵϴ͘Ϯϳϭϯ Ϭ Ϭ Ϭ͘ϬϬϬϰϮϭ Ϭ Ϭ Ϭ͘ϬϲϮϳϰϴ Ϭ Ϭ Ϭ͘ϬϬϵϬϳϰϬϬϬϬϬϬ͘ϬϭϬϯϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϳϭϭϮϲ Ϭ Ϭ Ϭ͘ϬϬϯϳϳϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϯϰϳ͘Ϯϭϳ ϰϬϱϰϳ͘ϲϲ Ϭ ϰϬϱϰϳ͘ϲϲ ϲϴϴϵ͘ϰϭϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϱϳϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϴϵϰ͘ϯϲϳϮ ϯϱϬϭϱ͘ϭϳ ϭϲϰϲϳ͘ϭϭ ϭϴϱϰϴ͘Ϭϲ ϯϲϵϴ͘ϮϬϴ Ϭ͘ϬϬϯϬϮϭ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϱϬϵ Ϭ Ϭ͘ϬϬϭϴϮϵ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯ Ϭ͘ϬϬϬϱϱϯ Ϭ Ϭ͘ϬϬϭϵϴϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴ ϭϮϲ͘ϵϮϵϲ Ϭ ϵϮ͘ϵϬϳϲϭ Ϭ͘ϬϬϬϯϵϭ Ϭ Ϭ͘ϬϰϮϮϴϵ Ϭ͘ϬϬϬϱϮϭ Ϭ Ϭ͘ϬϮϬϭϴϴ Ϭ͘ϬϬϭϮϳ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϴϭϭϱϬ͘ϬϮϰϵϰϯ Ϭ͘ϯϭϬϬϭϳ Ϭ͘ϬϬϭϴϱϯ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϴϭϭϱ Ϭ͘ϬϮϰϵϰϯ Ϭ͘ϯϭϬϬϭϳ Ϭ͘ϬϭϵϳϱϮ Ϭ͘ϭϴϵϲϮϳ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϱϱ Ϭ Ϭ͘ϬϬϬϵϭϴ^ĂŶDĂƚĞŽ ϮϬϮϰ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϬϭ͘ϴϰϳϵ ϳϳϴϲ͘ϯϯϵ ϳϳϴϲ͘ϯϯϵ Ϭ ϴϬ͘Ϯϭϲϴϲ Ϭ͘ϯϭϰϭϮ Ϭ Ϭ͘ϰϬϯϯϰϰ Ϭ͘ϬϬϭϲϮϲ Ϭ Ϭ͘ϬϬϬϰϭϰ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϳϲϴ Ϭ Ϭ͘ϬϬϬϰϱ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϵϰϲ͘ϱϱϰ Ϭ ϯϭ͘ϱϵϯϳϵ Ϭ͘Ϭϭϭϳϯϰ Ϭ Ϭ͘ϬϯϳϭϬϲ Ϭ͘ϬϮϭϭϱϰ Ϭ Ϭ͘Ϭϰϯϯϰϰ Ϭ͘ϬϰϵϬϵϭ Ϭ Ϭ͘ϭϱϰϳϲϴ ϵ͘ϲϵϭϮϳϰ Ϭ͘ϮϮϵϵϯϮ ϯ͘ϰϳϯϰϳϵ Ϭ͘Ϭϳϭϲϯϯ Ϭ Ϭ͘ϭϲϵϰϱϭ ϵ͘ϲϵϭϮϳϰ Ϭ͘ϮϮϵϵϯϮ ϯ͘ϰϳϯϰϳϵ Ϭ͘Ϭϰϰϵϭϴ ϭ͘ϭϯϳϳϵϮ Ϭ ϯ͘ϰϳϬϲϴϴ Ϭ͘ϬϭϵϮϰϰϬ Ϭ͘ϬϬϬϯϭϮ^ĂŶDĂƚĞŽ ϮϬϮϰ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϯϱϲ͘ϲϱϬϵ ϯϲϵϯ͘ϱϭϴ ϯϲϵϯ͘ϱϭϴϬ ϯϱ͘ϲϲϱϬϵ ϯ͘ϬϵϲϮϯϯ Ϭ Ϭ Ϭ͘Ϭϰϵϱϳϴ Ϭ Ϭ Ϭ͘ϬϬϰ Ϭ͘Ϭϭϱϲϳϱ Ϭ͘ϬϱϭϴϮ Ϭ Ϭ Ϭ͘Ϭϭϲ Ϭ͘Ϭϰϰϳϴϱ ϭϬϴϱ͘ϳϵϱ Ϭ Ϭ Ϭ͘ϬϬϰϮϮϱ Ϭ Ϭ Ϭ͘ϭϳϭϬϲϳ Ϭ Ϭ Ϭ͘ϬϵϬϵϲϭϬϬϬϬϬϬ͘ϭϬϯϱϱϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϵϬϴϯϱ Ϭ͘Ϯϴϰϱϵϳ Ϭ Ϭ Ϭ͘ϬϭϬϮϴϴ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϬϯ͘ϱϳϬϳ ϰϲϵϵϳ͘ϭϰ ϰϲϵϵϳ͘ϭϰ Ϭ ϭϲϬϳϳ͘ϴϰ Ϭ͘ϯϵϮϳϬϲ Ϭ͘ϬϴϴϲϲϮ Ϭ͘ϰϰϬϭϬϲ Ϭ͘ϬϬϭϯϲϮ Ϭ Ϭ͘ϬϬϬϱϮϰ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϰϴϭ Ϭ Ϭ͘ϬϬϬϱϳ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϳϯϴ͘Ϯϭϳ ϱϮϰ͘ϬϮϳϭ ϰϱ͘ϯϬϭϲϳ Ϭ͘ϬϭϮϲϲϴ Ϭ͘Ϯϲϰϳϯϱ Ϭ͘Ϭϰϲϵϯϯ Ϭ͘ϬϮϬϭϵϭ Ϭ͘ϬϬϳϱϳϳ Ϭ͘Ϭϯϰϰϳϱ Ϭ͘Ϭϲϭϳϲϲ ϭ͘ϬϭϱϯϮϵ Ϭ͘ϮϱϰϳϮϱ Ϭ͘ϬϯϬϬϴϳ Ϭ͘ϮϰϲϴϲϮ Ϯ͘ϯϱϯϲϭϮ Ϭ͘ϬϵϬϭϮϵ ϭ͘ϰϴϭϱϲϲ Ϭ͘ϮϳϴϴϵϮ Ϭ͘ϬϯϬϬϴϳ Ϭ͘ϮϰϲϴϲϮ Ϯ͘ϯϱϯϲϭϮ Ϭ͘Ϭϰϰϵϴϲ ϭ͘ϮϳϰϬϴϯ ϭϱ͘ϭϰϲϴϯ ϱ͘ϲϬϯϰϱϴ Ϭ͘Ϭϭϳϭϴϰ Ϭ͘ϬϬϱϭϴϭ Ϭ͘ϬϬϬϰϰϴ^ĂŶDĂƚĞŽ ϮϬϮϰ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϮϯϯ͘Ϯϯϯ ϭϳϳϬϮϴ ϭϳϳϬϮϴ Ϭ ϱϭϬϱϭ͘Ϭϰ ϭ͘ϯϬϳϮϴϰ ϭϯ͘ϱϳϰϱϲ ϭ͘ϲϬϳϲϱϱ Ϭ͘ϬϭϲϮϱϵ Ϭ͘Ϭϯϯϱϭϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϵϴϯ Ϭ͘Ϭϭϲϵϵϰ Ϭ͘ϬϯϱϬϮϲ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϲϲϰ ϭϭϱϭ͘ϯϰϰ ϮϮϰϴ͘ϰϵϭ Ϭ Ϭ͘ϬϬϭϳϰϴ Ϭ͘Ϭϭϭϵϴϱ Ϭ Ϭ͘ϭϴϭϯϵϱ Ϭ͘ϯϱϰϮϱϭ Ϭ Ϭ͘Ϭϯϳϲϯϱ Ϭ͘ϮϱϴϬϰϯϬϬϬϬϬ͘ϬϰϮϴϰϱ Ϭ͘ϮϵϯϳϲϯϬϬϬϬϬ͘ϮϬϴϳϮϰ Ϭ͘ϭϯϰϰϰ ϳ͘ϱϰϳϱϴϴ Ϭ Ϭ͘ϬϭϬϵϬϯ Ϭ͘ϬϮϭϮϵϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϰ͘ϮϴϮϯϯ ϴϳϭ͘Ϭϴϳϱ Ϭϴϳϭ͘Ϭϴϳϱ ϮϬϲ͘ϯϭϭϵ Ϭ ϬϬϬϬϬϬ͘ϬϬϯϬ͘ϬϬϳϵϱϭ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϳϭϴϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϰϬ͘ϵϰϲϴϮ ϭϵϯϱ͘ϴϲϯ ϭϵϯϱ͘ϴϲϯ Ϭ ϯϲϵ͘ϮϴϮϳ Ϭ͘ϭϮϲϲϮϳ ϲ͘ϱϳϴϯϲϯ Ϭ Ϭ͘ϬϬϭϮϲ Ϭ͘ϬϭϵϬϯϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϲϬϵϱ Ϭ͘ϬϬϭϯϳϭ Ϭ͘ϬϮϬϲϵϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϵϴϲ ϭϬϬϯ͘ϯϯϯ ϱϰϱϮ͘ϭϭϮ Ϭ Ϭ͘ϳϳϯϭϱϮ ϭϳ͘Ϯϳϲϭϰ Ϭ Ϭ͘ϮϬϰϱϯϲ ϭ͘ϭϭϭϰϰϵ Ϭ Ϭ͘ϬϭϭϬϰϳ Ϭ͘ϮϰϲϴϰϮϬϬϬϬϬ͘ϳϴϵϬϱϴ ϭϳ͘ϲϯϭϱϳ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘Ϭϲϲϴϱϯ ϯϲ͘ϲϳϬϱϱϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϱϰ͘ϭϵϲϳ ϭϰϰϯϴ͘ϲϴ ϭϰϰϯϴ͘ϲϴ Ϭ ϱϬϴϱ͘ϵϲϳ Ϭ͘Ϯϳϲϲϴϳ Ϭ͘ϬϲϱϭϬϵ Ϭ͘ϯϳϬϲϳϰ Ϭ͘ϬϬϭϬϮ Ϭ Ϭ͘ϬϬϬϮϴϯ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϲϴ Ϭ͘ϬϬϭϭϭ Ϭ Ϭ͘ϬϬϬϯϬϴ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϳϵϵ ϭϳϮϯ͘ϭϬϭ ϯϳϬ͘ϳϱϳϰ Ϯϵ͘ϵϳϲϳϲ Ϭ͘ϬϬϴϰϳϴϬ͘ϮϬϱϱϭϮ Ϭ͘ϬϯϮϴϭϴ Ϭ͘ϬϭϲϬϬϳ Ϭ͘ϬϬϱϵϭϵ Ϭ͘Ϭϯϭϴϳϵ Ϭ͘Ϭϯϵϱϯϱ Ϭ͘ϳϰϲϵϴϰ Ϭ͘ϭϲϮϰϮϴ Ϭ͘ϬϮϱϳϴϴ Ϭ͘ϭϭϯϯϭ ϭ͘ϵϮϲϮϭ Ϭ͘Ϭϱϳϲϵ ϭ͘Ϭϴϵϵϵϴ Ϭ͘ϭϳϳϴϯϴ Ϭ͘ϬϮϱϳϴϴ Ϭ͘ϭϭϯϯϭ ϭ͘ϵϮϲϮϭ Ϭ͘Ϭϰϰϵϰϳ Ϭ͘ϴϰϳϳϵϮ ϱ͘ϳϳϴϵϯϭ ϯ͘ϯϵϲϮϮϭ Ϭ͘ϬϭϳϬϯϱ Ϭ͘ϬϬϯϲϲϱ Ϭ͘ϬϬϬϮϵϲ^ĂŶDĂƚĞŽ ϮϬϮϰ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϬϳϳ͘ϰϵϯ ϳϱϬϬϮ͘ϯϲ ϳϱϬϬϮ͘ϯϲ Ϭ ϭϬϱϯϵ͘ϳ Ϭ͘ϴϯϱϮϯϴ ϱ͘ϳϱϵϯϳϴ ϭ͘ϱϭϬϰϴϮ Ϭ͘ϬϬϵϰϵϳ Ϭ͘ϬϬϯϮϴϰ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϳϯϳϲ Ϭ͘ϬϬϵϵϮϳ Ϭ͘ϬϬϯϰϯϯ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϵϲϰϳ ϭϮϰϭ͘ϵϭϭ ϭϮϭϲ͘ϭϭ Ϭ Ϭ͘ϬϬϬϵϯϲ Ϭ͘ϬϭϯϵϴϱϬ Ϭ͘ϭϵϱϲϲϰ Ϭ͘ϭϵϭϱϵϵ Ϭ Ϭ͘ϬϮϬϭϱϳ Ϭ͘ϯϬϭϬϵϯϬϬϬϬϬ͘ϬϮϮϵϰϳ Ϭ͘ϯϰϮϳϳϮ Ϭ Ϭ Ϭ Ϭ Ϭ͘Ϯϭϳϳϱϰ Ϭ͘Ϭϵϯϵϭϴ ϱ͘ϲϯϭϭϲϳ Ϭ Ϭ͘Ϭϭϭϳϲ Ϭ͘Ϭϭϭϱϭϲ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϭ͘ϴϳϯϰϬϲ ϳϵ͘ϱϴϬϳϲ Ϭϳϵ͘ϱϴϬϳϲ ϭϳ͘ϰϳϱϭϮ Ϭ ϬϬϬϬϬϬ͘ϬϬϯϬ͘ϬϬϳϴϰ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϯϵϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϳ͘ϳϵϳϱϮϴ ϰϵϮ͘ϱϱϴϱ ϰϵϮ͘ϱϱϴϱ Ϭ ϲϵ͘ϯϵϴ Ϭ͘ϭϵϲϯϳϰ ϭ͘ϱϰϮϰϰϲ Ϭ Ϭ͘ϬϬϭϬϯϭ Ϭ͘ϬϬϯϳϳϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϲϭϰϴ Ϭ͘ϬϬϭϭϮϭ Ϭ͘ϬϬϰϭϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϲϭϯϳ ϭϬϭϮ͘ϯϯϭ ϭϭϵϴ͘ϭϳϳ Ϭ Ϭ͘ϳϴϲϰϬϵ ϰ͘ϮϵϵϬϭϵ Ϭ Ϭ͘ϮϬϲϯϳ Ϭ͘ϮϰϰϮϱϲ Ϭ Ϭ͘ϬϭϭϮϯϲ Ϭ͘ϬϲϭϰϮϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϴϬϮϱϴϴ ϰ͘ϯϴϳϰϲϰ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘ϮϰϱϮϳ͘ϬϴϮϰϲϮ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϲ͘ϴϴϭϰϭ ϯϱϲϭ͘ϱϰϵ ϯϱϲϭ͘ϱϰϵ Ϭ Ϯϲϳ͘ϱϮϱϲ Ϭ͘ϴϯϱϮϮϯ Ϭ͘ϵϮϯϴϮ Ϭ͘ϲϯϵϴϯϭ Ϭ͘ϬϬϭϭϱϮ Ϭ Ϭ͘ϬϬϬϳϮϰ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϭϮϱϮ Ϭ Ϭ͘ϬϬϬϳϴϳ Ϭ͘ϬϬϴ Ϭ͘Ϭϰϰϵϭϳ ϳϴϵ͘ϰϰϮ Ϯϱϭϵ͘ϴϴϲ ϲϭ͘ϬϬϰϴϳ Ϭ͘ϬϭϵϲϯϮ͘ϰϰϲϯϬϮ Ϭ͘Ϭϴϳϴϳϰ Ϭ͘Ϭϯϵϭϯϱ Ϭ͘ϬϴϱϮϬϳ Ϭ͘Ϭϱϲϴϳϱ Ϭ͘Ϭϵϲϭϭ ϭϬ͘ϲϬϭϵϭ Ϭ͘ϱϬϵϴϬϱϬ͘ϭϯϯϭϮϮ Ϭ͘ϯϵϵϱϵϭ Ϯ͘Ϭϳϲϴϴϱ Ϭ͘ϭϰϬϮϰϯ ϭϱ͘ϰϳϬϮϵ Ϭ͘ϱϱϴϭϳϯ Ϭ͘ϭϯϯϭϮϮ Ϭ͘ϯϵϵϱϵϭ Ϯ͘Ϭϳϲϴϴϱ Ϭ͘Ϭϰϱ Ϯ͘ϰϲϬϮϬϮ ϴϮ͘ϬϬϬϯϴ ϭϮ͘ϳϮϬϴϭ Ϭ͘ϬϬϳϴϬϰ Ϭ͘ϬϮϰϵϭϮ Ϭ͘ϬϬϬϲϬϯ^ĂŶDĂƚĞŽ ϮϬϮϰ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϲϴ͘ϵϲ ϯϳϳϳ͘ϮϬϮ ϯϳϳϳ͘ϮϬϮϬ Ϯϰϰϲ͘ϱϰϭ ϰ͘ϲϵϲϳϭϮ Ϯϯ͘ϮϬϱϯϲ Ϭ͘ϰϱϵϮϱϯ Ϭ͘ϬϮϮϰϬϵ Ϭ͘ϬϮϯϳϮϲ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭϬ͘ϬϮϯϰϮϮ Ϭ͘ϬϮϰϳϵϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϭϰϰ͘ϯϭϭ ϮϮϯϲ͘ϱϵϯ Ϭ Ϭ͘ϬϬϯϭϭϮ Ϭ͘ϬϬϴϮϬϴϬ Ϭ͘ϭϴϬϮϴϳ Ϭ͘ϯϱϮϯϳϲ Ϭ Ϭ͘Ϭϲϳ Ϭ͘ϭϳϲϳϭϲϬϬϬϬϬ͘ϬϳϲϮϳϱ Ϭ͘ϮϬϭϭϳϳ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϯϵϭϴϳ Ϭ͘ϮϬϮϯϳϮ ϰ͘ϰϭϳϱϳϯ Ϭ Ϭ͘ϬϭϬϴϯϲ Ϭ͘ϬϮϭϭϳϵ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϭ͘ϵϬϴϴϯ ϯϲ͘ϲϮϬϱϳ Ϭ ϯϲ͘ϲϮϬϱϳ ϴ͘ϭϰϬϮϭϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮϯϬϰ Ϭ͘ϬϬϳϴϲ Ϭ Ϭ Ϭ Ϭ͘ϬϬϵϮϭϰ Ϭ͘ϬϮϮϰϱϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲ͘Ϯϴϴϲϭϰ ϭϱϴ͘ϲϬϵϳ ϭϱϴ͘ϲϬϵϳ Ϭ ϵϭ͘Ϭϱϵϭϯ Ϭ͘ϱϯϱϮϭϱ ϱ͘Ϯϱϭϯϴϵ Ϭ Ϭ͘ϬϬϯϯϳϴ Ϭ͘ϬϭϭϴϮϯ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϯϲϳϰ Ϭ͘ϬϭϮϴϱϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϮϰϳ͘ϯϱϰ ϰϬϴϴ͘ϲϳϮ Ϭ ϯ͘ϯϱϬϯϮ ϭϱ͘Ϭϭϱϴϭ Ϭ Ϭ͘ϮϱϰϮϴϭ Ϭ͘ϴϯϯϱϬϮ Ϭ Ϭ͘Ϭϰϳϴϲϵ Ϭ͘ϮϭϰϱϰϲϬϬϬϬϯ͘ϰϭϵϮϰϳ ϭϱ͘ϯϮϰϳϰ Ϭ Ϭ Ϭ Ϭϭ͘Ϭϲ ϭϭ͘ϮϰϮϲϰ Ϯϭ͘ϳϵϱϵϴϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϭ͘ϰϰϰϭϴ ϰϭϳϴ͘Ϭϭ ϰϭϳϴ͘Ϭϭ Ϭ Ϯϰϱ͘ϳϳϲϳ Ϭ͘ϬϯϲϮϯϱ Ϭ Ϭ͘ϱϬϬϮϱϭ Ϭ͘ϬϬϭϬϴϯ Ϭ Ϭ͘ϬϬϬϭϰϴ Ϭ͘ϬϬϮϬϳϯ Ϭ͘ϬϯϮϯϯϯ Ϭ͘ϬϬϭϭϳϴ Ϭ Ϭ͘ϬϬϬϭϲϭ Ϭ͘ϬϬϴϮϵ Ϭ͘ϬϵϮϯϳϵ ϭϬϬϮ͘ϯϭϳ Ϭ ϰϬ͘Ϯϳϰϱ Ϭ͘ϬϬϮϭϭ Ϭ Ϭ͘Ϭϰϲϱϯϴ Ϭ͘ϬϬϰϴϱϯ Ϭ Ϭ͘Ϭϲϵϲϱϴ Ϭ͘ϬϬϲϭϭϳ Ϭ Ϭ͘ϭϳϱϬϰϯ Ϭ͘ϬϱϬϬϳϮ Ϭ͘ϬϵϲϮϴϭ Ϭ͘ϱϬϱϵϰϳ Ϭ͘ϬϬϴϵϮϱ Ϭ Ϭ͘ϭϵϭϲϱ Ϭ͘ϬϱϬϬϳϮ Ϭ͘ϬϵϲϮϴϭ Ϭ͘ϱϬϱϵϰϳ Ϭ͘Ϭϰϱ Ϭ͘ϱϱϲϲϳϱ Ϭ ϲ͘ϭϲϵϵϵϲ Ϭ͘ϬϬϵϵϬϵ Ϭ Ϭ͘ϬϬϬϯϵϴ^ĂŶDĂƚĞŽ ϮϬϮϰ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϳϳ͘ϱϴϵϯ Ϯϭϰϳϳ͘ϳϴ Ϯϭϰϳϳ͘ϳϴ Ϭ ϭϭϭϬ͘ϯϱϳ Ϭ͘ϯϳϱϱϲϱ Ϭ Ϭ Ϭ͘ϬϬϲϴϮϳ Ϭ Ϭ Ϭ͘ϬϬϴϬϵϳ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϳϭϯϲ Ϭ Ϭ Ϭ͘ϬϯϮϯϴϴϬ͘ϭϭ ϭϮϮϯ͘ϳϮϳ Ϭ Ϭ Ϭ͘ϬϬϯϭϰϱ Ϭ Ϭ Ϭ͘ϭϵϮϳϵϵ Ϭ Ϭ Ϭ͘ϬϲϳϳϭϵϬϬϬϬϬϬ͘ϬϳϳϬϵϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϮ Ϭ͘Ϭϳϳϭϵϱ Ϭ Ϭ Ϭ͘Ϭϭϭϱϵϱ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϰ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯϳ͘Ϭϳϵϰ ϯϴϱϭ͘ϯϬϯ Ϭ ϯϴϱϭ͘ϯϬϯ ϭϰϴ͘ϯϭϳϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϳϯϲϲ Ϭ͘ϬϭϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϮϵϰϲϲ Ϭ͘ϬϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϰ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲϱ͘Ϯϲϭϭϰ ϰϱϭϰ͘ϱϳϯ ϰϱϭϰ͘ϱϳϯ Ϭ Ϯϲϭ͘Ϭϰϰϲ Ϭ͘ϬϱϱϰϮϰ Ϭ Ϭ Ϭ͘ϬϬϬϮϳϮ Ϭ Ϭ Ϭ͘ϬϬϳϳϰϭ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϬϮϴϱ Ϭ Ϭ Ϭ͘ϬϯϬϵϲϯ Ϭ͘ϭϭ ϭϮϲϮ͘ϲϱϲ Ϭ Ϭ ϰ͘ϭϬϬϱϯϭ Ϭ Ϭ Ϭ͘ϮϱϳϰϬϭ Ϭ Ϭ Ϭ͘ϬϱϴϱϴϴϬϬϬϬϬϰ͘ϭϴϰϴϵϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϵϳ ϰϲ͘ϱϬϲϯϯϬϬϬϬϬ ^ŽƵƌĐĞ͗D&ϮϬϮϭ;ǀϭ͘Ϭ͘ϮͿŵŝƐƐŝŽŶZĂƚĞƐZĞŐŝŽŶdǇƉĞ͗ŽƵŶƚǇZĞŐŝŽŶ͗^ĂŶDĂƚĞŽĂůĞŶĚĂƌzĞĂƌ͗ϮϬϮϱ^ĞĂƐŽŶ͗ŶŶƵĂůsĞŚŝĐůĞůĂƐƐŝĨŝĐĂƚŝŽŶ͗D&ϮϬϬϳĂƚĞŐŽƌŝĞƐhŶŝƚƐ͗ŵŝůĞƐͬĚĂǇĨŽƌsDdĂŶĚsDd͕ƚƌŝƉƐͬĚĂǇĨŽƌdƌŝƉƐ͕ŐͬŵŝůĞĨŽƌZhEy͕WDtĂŶĚWDdt͕ŐͬƚƌŝƉĨŽƌ^dZy͕,Kd^K<ĂŶĚZhE>K^^͕ŐͬǀĞŚŝĐůĞͬĚĂǇĨŽƌ/>yĂŶĚ/hZE͘W,sĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŽƚĂůsDd͘ZĞŐŝŽŶ ĂůĞŶĚĂƌz sĞŚŝĐůĞĂƚDŽĚĞůzĞĂ ^ƉĞĞĚ &ƵĞů WŽƉƵůĂƚŝŽŶdŽƚĂůsDd sDd sDd dƌŝƉƐ EKǆͺZhEEKǆͺ/>yEKǆͺ^dZyWDϮ͘ϱͺZh WDϮ͘ϱͺ/>WDϮ͘ϱͺ^dZWDϮ͘ϱͺWDWDϮ͘ϱͺWDWDϭϬͺZhEWDϭϬͺ/>WDϭϬͺ^dZ WDϭϬͺWDdWDϭϬͺWDKϮͺZhEKϮͺ/>yKϮͺ^dZy,ϰͺZhE,ϰͺ/>y,ϰͺ^dZyEϮKͺZhEEϮKͺ/>yEϮKͺ^dZyZK'ͺZhEZK'ͺ/>yZK'ͺ^dZyZK'ͺ,Kd^ZK'ͺZhE>ZK'ͺ/hZdK'ͺZhEdK'ͺ/>ydK'ͺ^dZydK'ͺ,Kd^dK'ͺZhE>dK'ͺ/hZ E,ϯͺZhEKͺZhEyKͺ/>y Kͺ^dZy ^KǆͺZhE ^Kǆͺ/>y ^Kǆͺ^dZy^ĂŶDĂƚĞŽ ϮϬϮϱ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϰ͘ϯϯϱϵϴϰ ϱϯϵ͘ϰϰϯϰ ϱϯϵ͘ϰϰϯϰ Ϭ ϴϲ͘ϳϱϰϯϲ ϯ͘ϵϵϯϴϵϭ Ϭ Ϭ͘ϬϬϮϬϮϮ Ϭ͘ϬϬϭϯϳϴ Ϭ Ϭ͘ϬϬϬϲϵ Ϭ͘ϬϬϱ Ϭ͘ϬϯϭϬϬϲ Ϭ͘ϬϬϭϰϵϴ Ϭ Ϭ͘ϬϬϬϳϱϭ Ϭ͘ϬϮ Ϭ͘Ϭϴϴϱϴϵ ϮϮϮϯ͘ϳϰϯ Ϭ ϱϭ͘ϵϵϮϱϭ Ϭ͘ϭϭϭϭϳϭ Ϭ ϵ͘ϴϱͲϬϱ Ϭ͘ϭϱϭϮϮϭ Ϭ Ϭ͘ϬϬϬϭϬϰ Ϭ͘ϱϰϴϳϴϳ Ϭ Ϭ͘ϬϬϬϱϯϱ Ϭ͘ϬϯϮϯϮϳ Ϭ͘ϮϰϬϲϴϴ Ϯ͘ϭϲϬϭϬϰ Ϭ͘ϴϬϬϳϴϵ ϬϬ͘ϬϬϬϱϴϱ Ϭ͘ϬϯϮϯϮϳ Ϭ͘ϮϰϬϲϴϴ Ϯ͘ϭϲϬϭϬϰ Ϭ͘Ϭϰϱ ϯϯ͘Ϭϳϴϳ Ϭ ϱ͘Ϭϯϭϱϰϱ Ϭ͘ϬϮϭϵϴϰ Ϭ Ϭ͘ϬϬϬϱϭϰ^ĂŶDĂƚĞŽ ϮϬϮϱ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϯϮϴ͘ϰϭ ϭϭϵϱϲϬ͘ϳ ϭϭϵϱϲϬ͘ϳ Ϭ ϭϰϲϮϭ͘ϵϭ Ϯ͘ϲϯϮϬϮϱ ϰϱ͘ϰϭϮϳ ϯ͘ϬϬϬϰϯϭ Ϭ͘ϬϮϰϲϭ Ϭ͘Ϭϯϯϭϱϵ Ϭ Ϭ͘ϬϬϴϲϬϳ Ϭ͘ϬϯϬϯϵϳ Ϭ͘ϬϮϱϳϮϯ Ϭ͘Ϭϯϰϲϱϴ Ϭ Ϭ͘ϬϯϰϰϮϳ Ϭ͘Ϭϴϲϴϰϴ ϭϳϴϯ͘ϵϯϱ ϴϭϯϯ͘ϭϰϰ Ϭ Ϭ͘ϬϬϭϮϭϭ Ϭ͘ϭϱϴϭϱ Ϭ Ϭ͘ϮϴϭϬϲ ϭ͘Ϯϴϭϯϴ Ϭ Ϭ͘ϬϮϲϬϳ ϯ͘ϰϬϰϵϮϴϬϬϬϬϬ͘ϬϮϵϲϳϵ ϯ͘ϴϳϲϮϱϮ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϭϬϰϰ Ϭ͘ϭϭϯϯϯϱ ϰϳ͘ϳϱϯϴϲ Ϭ Ϭ͘Ϭϭϲϴϵϯ Ϭ͘ϬϳϳϬϭϲ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϬ͘ϬϮϯϴϰ ϵϬϭ͘ϬϬϮϮ ϬϵϬϭ͘ϬϬϮϮ ϵϲ͘Ϯϳϳϵϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴϱϭϳ Ϭ͘ϬϭϳϬϵϵ Ϭ Ϭ Ϭ Ϭ͘ϬϯϰϬϲϳ Ϭ͘ϬϰϴϴϱϰϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϴϬ͘ϱϱϰϵ ϭϭϴϰϮ͘ϲϲ ϭϭϴϰϮ͘ϲϲ Ϭ ϭϮϬϬ͘ϭϬϱ ϭ͘ϯϯϭϰϭϮ ϴ͘ϴϱϵϱϵϴ Ϭ Ϭ͘ϬϬϭϲϵϮ Ϭ͘ϬϭϮϮϯϮ Ϭ Ϭ͘ϬϬϵ Ϭ͘ϬϲϬϭϰϴ Ϭ͘ϬϬϭϴϰ Ϭ͘ϬϭϯϯϬϰ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϭϳϭϴϱϭ ϭϰϳϯ͘Ϯϳϰ ϴϯϬϴ͘ϭϯϱ Ϭ Ϯ͘ϳϵϮϴϵϴ ϮϮ͘ϱϳϱϭϴ Ϭ Ϭ͘ϯϬϬϯϯϳ ϭ͘ϲϵϯϲϲϴ Ϭ Ϭ͘Ϭϲϭϭϱϯ Ϭ͘ϯϲϬϬϬϳ Ϭ Ϭ Ϭ Ϭ Ϯ͘ϴϳϰϱϲϲ Ϯϯ͘ϬϴϮϯ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϳϮϬϲϱϴϭϱ͘ϴϮϬϱϲ ϲϯ͘ϬϰϬϳ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϯϴϲϭϴ ϳϭϴϱϲϴϵ ϳϭϴϱϲϴϵ ϬϭϭϭϵϴϳϮ Ϭ͘Ϭϯϰϲϭϱ Ϭ Ϭ͘Ϯϯϱϴϱϭ Ϭ͘ϬϬϭϭϮϴ Ϭ Ϭ͘ϬϬϭϵϭϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϰϵ Ϭ͘ϬϬϭϮϮϳ ϬϬ͘ϬϬϮϬϳϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϳϭ Ϯϲϱ͘Ϭϴϲϯ Ϭ ϲϳ͘ϮϲϬϲϴ Ϭ͘ϬϬϭϴϯϴ Ϭ Ϭ͘Ϭϲϯϴϲϲ Ϭ͘ϬϬϰ Ϭ Ϭ͘ϬϯϬϭϴϮ Ϭ͘ϬϬϲϵϳϱ Ϭ Ϭ͘Ϯϵϲϯϵϳ Ϭ͘ϬϴϬϲϮϯ Ϭ͘ϮϬϳϳϵϱ ϭ͘Ϯϰϲϲϯϲ Ϭ͘ϬϭϬϭϳϳ Ϭ Ϭ͘ϯϮϰϱϭϳϬ͘ϬϴϬϲϮϯ Ϭ͘ϮϬϳϳϵϱ ϭ͘Ϯϰϲϲϯϲ Ϭ͘Ϭϯϲϵϭϵ Ϭ͘ϲϬϮϲϲϰ Ϭ ϯ͘Ϭϭϴϵϴϵ Ϭ͘ϬϬϮϲϮϭ Ϭ Ϭ͘ϬϬϬϲϲϱ^ĂŶDĂƚĞŽ ϮϬϮϱ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϳϭϬ͘ϱϴϯϰ ϭϱϰϬϳ͘ϰϲ ϭϱϰϬϳ͘ϰϲ Ϭ ϮϵϴϬ͘ϮϮϳ Ϭ͘ϭϲϲϬϮϱ Ϭ Ϭ Ϭ͘ϬϭϭϰϮ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϰϭ Ϭ͘Ϭϭϭϵϯϳ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϴϴϰ ϮϮϵ͘ϳϯϮϮ Ϭ Ϭ Ϭ͘ϬϬϬϵϳ Ϭ Ϭ Ϭ͘Ϭϯϲϭϵϰ Ϭ Ϭ Ϭ͘ϬϮϬϴϳϳϬϬϬϬϬϬ͘ϬϮϯϳϲϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϮϵϮϰϭϱ Ϭ Ϭ Ϭ͘ϬϬϮϭϳϳ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϵϱϲϰ͘ϵϴ ϳϰϱϴϱϯ͘ϴ Ϭ ϳϰϱϴϱϯ͘ϴ ϵϲϴϮϱ͘ϱϭ ϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϯϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϴϬϰϰ͘ϭϭϳ ϮϴϯϱϬϵ͘ϰ ϭϯϰϱϰϴ͘ϭ ϭϰϴϵϲϭ͘ϰ ϯϯϮϲϮ͘ϰϮ Ϭ͘ϬϬϯϬϰϵ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϱϰϯ Ϭ Ϭ͘ϬϬϭϵϭϵ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯ Ϭ͘ϬϬϬϱϵϭ Ϭ Ϭ͘ϬϬϮϬϴϳ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴ ϭϮϴ͘Ϭϳϳϭ Ϭ ϲϯ͘ϭϰϬϲϵ Ϭ͘ϬϬϬϯϵ Ϭ Ϭ͘Ϭϰϭϳϳϳ Ϭ͘ϬϬϬϱϭϯ Ϭ Ϭ͘Ϭϭϵϳϭϯ Ϭ͘ϬϬϭϮϴϭ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϯϳϵϳϰϬ͘Ϭϯϯϴϱϭ Ϭ͘ϯϴϵϴϰϳ Ϭ͘ϬϬϭϴϳ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘Ϭϯϳϵϳϰ Ϭ͘Ϭϯϯϴϱϭ Ϭ͘ϯϴϵϴϰϳ Ϭ͘ϬϭϵϬϳϭ Ϭ͘ϭϵϭϯ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϲϲ Ϭ Ϭ͘ϬϬϬϲϮϰ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϱϰϳϯ͘Ϭϵ ϳϮϮϵϴϲ͘Ϯ ϳϮϮϵϴϲ͘Ϯ Ϭ ϭϭϲϲϬϴ͘ϭ Ϭ͘Ϭϴϴϰϲϱ Ϭ Ϭ͘ϯϭϯϴϭϵ Ϭ͘ϬϬϭϰϮϴ Ϭ Ϭ͘ϬϬϮϮϴϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϭϵ Ϭ͘ϬϬϭϱϱϰ Ϭ Ϭ͘ϬϬϮϰϴϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϱϲ ϯϭϬ͘ϱϮϰϭ Ϭ ϴϬ͘ϳϱϯϲϵ Ϭ͘ϬϬϰϭϯϴ Ϭ Ϭ͘Ϭϴϯϴϳϲ Ϭ͘ϬϬϲϵϬϴ Ϭ Ϭ͘ϬϯϯϵϮϭ Ϭ͘ϬϭϴϭϬϱ Ϭ Ϭ͘ϰϮϭϬϭϳ Ϭ͘ϭϮϯϯϭϰ Ϭ͘ϯϰϯϮϴϭ ϭ͘ϵϰϴϮϭϵ Ϭ͘ϬϮϲϰϭϴ Ϭ Ϭ͘ϰϲϬϵϲϭ Ϭ͘ϭϮϯϯϭϰ Ϭ͘ϯϰϯϮϴϭ ϭ͘ϵϰϴϮϭϵ Ϭ͘Ϭϯϳϵϵϳ Ϭ͘ϵϵϲϭϵϴ Ϭ ϰ͘Ϯϰϱϯϭϲ Ϭ͘ϬϬϯϬϳ Ϭ Ϭ͘ϬϬϬϳϵϴ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲ͘Ϯϵϳϭϵϲ ϳϱ͘ϵϭϬϲϭ ϳϱ͘ϵϭϬϲϭ Ϭ ϭϳ͘ϲϲϮϵ ϭ͘ϲϯϯϮϰϭ Ϭ Ϭ Ϭ͘ϮϯϯϮϮϳ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϯϯϭϰ Ϭ͘Ϯϰϯϳϳϯ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϰϲϳ ϰϭϲ͘ϰϬϱ Ϭ Ϭ Ϭ͘Ϭϭϰϯϲϲ Ϭ Ϭ Ϭ͘ϬϲϱϲϬϱ Ϭ Ϭ Ϭ͘ϯϬϵϮϴϮϬϬϬϬϬϬ͘ϯϱϮϬϵϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ ϭ͘ϲϰϱϰϵϴ Ϭ Ϭ Ϭ͘ϬϬϯϵϰϲ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϭϰ͘ϯϬϭϯ ϰϮϬϳ͘ϵϳϵ ϬϰϮϬϳ͘ϵϳϵ ϱϱϳ͘ϵϯϵϰ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϮ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϲϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϳϴ͘ϲϵϳϯϲ ϯϬϭϵ͘ϱϵϵ ϭϯϬϵ͘ϲϯϱ ϭϳϬϵ͘ϵϲϰ ϯϮϱ͘ϰϭϯϲ Ϭ͘ϬϬϮϳϴϲ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϱ Ϭ Ϭ͘ϬϬϭϯϲϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϱ Ϭ͘ϬϬϬϯϴϭ Ϭ Ϭ͘ϬϬϭϰϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϰϮ ϭϭϳ͘Ϭϲϳϭ Ϭ ϲϳ͘ϴϭϬϭϳ Ϭ͘ϬϬϬϯϱϲ Ϭ Ϭ͘Ϭϰϭϳϱϴ Ϭ͘ϬϬϬϰϲϴ Ϭ Ϭ͘Ϭϭϵϲϵϰ Ϭ͘ϬϬϭϭϳϭ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϯϳϱϭ Ϭ͘ϬϮϬϮϰϵ Ϭ͘Ϯϲϲϴϰϴ Ϭ͘ϬϬϭϳϬϵ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϯϳϱϭ Ϭ͘ϬϮϬϮϰϵ Ϭ͘Ϯϲϲϴϰϴ Ϭ͘ϬϭϴϮϭϲ Ϭ͘ϭϳϰϵϮϯ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϱϳ Ϭ Ϭ͘ϬϬϬϲϳ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϱϵϲϳϯ͘ϲ ϱϬϳϮϭϰϰ ϱϬϳϮϭϰϰ Ϭ ϳϲϲϯϵϳ͘Ϯ Ϭ͘Ϭϰϯϭϱϱ Ϭ Ϭ͘ϮϱϵϬϯϴ Ϭ͘ϬϬϭϭϭϭ Ϭ Ϭ͘ϬϬϭϴϮϰ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϮϱ Ϭ͘ϬϬϭϮϬϴ Ϭ Ϭ͘ϬϬϭϵϴϯ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϳϴϱ ϯϭϴ͘ϭϲϲ Ϭ ϴϬ͘ϲϮϰϮϱ Ϭ͘ϬϬϭϵϳϲ Ϭ Ϭ͘Ϭϲϲϯϴϯ Ϭ͘ϬϬϰϯϰϵ Ϭ Ϭ͘Ϭϯϭϵϵϵ Ϭ͘ϬϬϳϯϴϲ Ϭ Ϭ͘Ϯϵϵϭϳϴ Ϭ͘Ϭϱϲϲϭϰ Ϭ͘ϭϰϱϬϭϲ Ϭ͘ϵϭϭϴϵϲ Ϭ͘ϬϭϬϳϳϳ Ϭ Ϭ͘ϯϮϳϱϲϯ Ϭ͘Ϭϱϲϲϭϰ Ϭ͘ϭϰϱϬϭϲ Ϭ͘ϵϭϭϴϵϲ Ϭ͘ϬϯϵϬϵϯ Ϭ͘ϲϭϲϲϵϲ Ϭ ϯ͘ϬϳϱϮϭϭ Ϭ͘ϬϬϯϭϰϱ Ϭ Ϭ͘ϬϬϬϳϵϳ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲϭϴ͘ϵϮϳϲ ϭϵϰϰϳ͘Ϯϰ ϭϵϰϰϳ͘Ϯϰ Ϭ ϮϵϳϮ͘ϯϱϲ Ϭ͘Ϭϯϱϯϭϲ Ϭ Ϭ Ϭ͘ϬϬϰϭϰϳ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϰϲ Ϭ͘ϬϬϰϯϯϰ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϰϱ Ϯϵϱ͘ϵϬϮϰ Ϭ Ϭ Ϭ͘ϬϬϬϱϲ Ϭ Ϭ Ϭ͘ϬϰϲϲϮ Ϭ Ϭ Ϭ͘ϬϭϮϬϱϳϬϬϬϬϬϬ͘ϬϭϯϳϮϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϭϲϴϯϳ Ϭ Ϭ Ϭ͘ϬϬϮϴϬϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϳϬϬ͘ϱϬϮ ϰϴϴϭϵ͘ϰ Ϭ ϰϴϴϭϵ͘ϰ ϴϲϱϰ͘ϮϮϮϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϲ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϲϭϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϭϵϴϵ͘ϰϲϲ ϳϮϳϴϳ͘Ϯϲ ϯϯϬϯϮ͘ϵϱ ϯϵϳϱϰ͘ϯϭ ϴϮϮϲ͘ϰϰϰ Ϭ͘ϬϬϮϵϭϲ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϮ Ϭ Ϭ͘ϬϬϭϱϲ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯϳ Ϭ͘ϬϬϬϰϱϳ Ϭ Ϭ͘ϬϬϭϲϵϲ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϮϭ ϭϮϮ͘ϰϴϴϱ Ϭ ϳϯ͘ϴϴϱϮϵ Ϭ͘ϬϬϬϯϳϮ Ϭ Ϭ͘Ϭϰϭϳϰϲ Ϭ͘ϬϬϬϰϵ Ϭ Ϭ͘Ϭϭϵϲϴϯ Ϭ͘ϬϬϭϮϮϱ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϱϯϱϯ Ϭ͘ϬϮϮϳϭ Ϭ͘Ϯϴϳϵϱϯ Ϭ͘ϬϬϭϳϴϴ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϱϯϱϯ Ϭ͘ϬϮϮϳϭ Ϭ͘Ϯϴϳϵϱϯ Ϭ͘ϬϭϵϬϰϴ Ϭ͘ϭϴϮϵϵϰ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϭϭ Ϭ Ϭ͘ϬϬϬϳϯ^ĂŶDĂƚĞŽ ϮϬϮϱ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϭϲϭϯ͘ϴϮ ϰϬϱϵϮϳ͘Ϯ ϰϬϱϵϮϳ͘Ϯ Ϭ ϭϳϯϬϮϴ͘ϱ Ϭ͘Ϭϵϯϵϲϵ Ϭ͘ϬϯϮϲϭϴ Ϭ͘ϱϰϲϳϴϴ Ϭ͘ϬϬϭϯϱ Ϭ Ϭ͘ϬϬϬϮϭϯ Ϭ͘ϬϬϮ Ϭ͘ϬϮϳϯ Ϭ͘ϬϬϭϰϲϴ Ϭ Ϭ͘ϬϬϬϮϯϭ Ϭ͘ϬϬϴ Ϭ͘Ϭϳϴ ϴϮϯ͘Ϯϲϱϳ ϭϭϱ͘ϯϵϱϰ Ϯϲ͘ϱϬϬϲϵ Ϭ͘ϬϬϰϵϬϯ Ϭ͘ϭϬϰϭϳϴ Ϭ͘ϬϮϳϯϬϮ Ϭ͘ϬϬϱϰϭϴ Ϭ͘ϬϬϮϴϰϳ Ϭ͘Ϭϰϲϲϯϴ Ϭ͘ϬϮϯϲϳϵ Ϭ͘ϯϳϰϬϮϳ Ϭ͘ϭϯϭϴϱϰ Ϭ͘ϬϯϭϰϮ Ϭ͘ϭϳϭϰϮϭ ϭ͘ϳϯϲϵϬϵ Ϭ͘ϬϯϰϱϱϮ Ϭ͘ϱϰϱϳϳϵ Ϭ͘ϭϰϰϯϲϰ Ϭ͘ϬϯϭϰϮ Ϭ͘ϭϳϭϰϮϭ ϭ͘ϳϯϲϵϬϵ Ϭ͘Ϭϰϰϵϲϭ Ϭ͘ϴϴϱϮϯϲ ϯ͘ϳϲϲϬϲϳ ϯ͘ϯϲϯϲϴ Ϭ͘ϬϬϴϭϯϵ Ϭ͘ϬϬϭϭϰϭ Ϭ͘ϬϬϬϮϲϮ^ĂŶDĂƚĞŽ ϮϬϮϱ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϱϯϵϲ͘ϳϭϭ ϮϬϬϯϯϱ͘ϯ ϮϬϬϯϯϱ͘ϯ Ϭ ϲϳϴϴϯ͘ϴϰ Ϭ͘ϴϳϴϭϯϳ ϭ͘ϱϭϴϭϰ Ϭ Ϭ͘ϬϮϮϯϵϭ Ϭ͘ϬϮϲϲϲϲ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϮϳϯ Ϭ͘ϬϮϯϰϬϰ Ϭ͘ϬϮϳϴϳϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϳϴ ϲϮϭ͘ϭϲϳϴ ϭϮϰ͘ϵϵϯϮ Ϭ Ϭ͘ϬϬϱϳϭϲ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘Ϭϵϳϴϲϱ Ϭ͘Ϭϭϵϲϵϯ Ϭ Ϭ͘ϭϮϯϬϱϯ Ϭ͘ϭϬϵϳϲ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϰϬϬϴϴ Ϭ͘ϭϮϰϵϱϰϬϬϬϬϬ͘ϭϵϲϬϭϰ Ϭ͘ϯϬϭϲϰϱ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϱϴϴϲ Ϭ͘ϬϬϭϭϴϰ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϱϳ͘ϱϴϰϭ ϴϳϴϲ͘ϱϰϲϬ ϴϳϴϲ͘ϱϰϲ ϮϮϬϯ͘ϳϳϱ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϭϯϲϱϬϬϬϬ͘ϬϬϴϬ͘ϬϯϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϯϰϮ͘ϰϮϵ ϰϱϬϯϭ͘ϱ ϰϱϬϯϭ͘ϱ Ϭ ϮϬϬϬϬ͘ϭϵ Ϭ͘ϭϬϱϭϯϱ Ϭ͘Ϭϯϭϯϴϲ Ϭ͘ϱϰϲϬϰϯ Ϭ͘ϬϬϭϮϴϮ Ϭ Ϭ͘ϬϬϬϭϴϱ Ϭ͘ϬϬϮ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϬϭϯϵϱ Ϭ Ϭ͘ϬϬϬϮϬϭ Ϭ͘ϬϬϴ Ϭ͘Ϭϵϭ ϵϮϵ͘ϭϭϵ ϭϯϯ͘ϲϱϴ Ϯϱ͘Ϭϱϴϲϭ Ϭ͘ϬϬϰϭϮ Ϭ͘ϬϵϵϱϬϲ Ϭ͘ϬϮϲϳϬϮ Ϭ͘ϬϬϲϰϰϱ Ϭ͘ϬϬϮϲϱ Ϭ͘Ϭϰϰϳϯϲ Ϭ͘Ϭϭϴϲϲϰ Ϭ͘ϯϲϬϬϬϭ Ϭ͘ϭϮϵϱϯ Ϭ͘ϬϯϮϴϰϲ Ϭ͘ϭϳϴϬϳϭ ϭ͘ϴϰϱϵϬϰ Ϭ͘ϬϮϳϮϯϰ Ϭ͘ϱϮϱϯϭϯ Ϭ͘ϭϰϭϴϭϵ Ϭ͘ϬϯϮϴϰϲ Ϭ͘ϭϳϴϬϳϭ ϭ͘ϴϰϱϵϬϰ Ϭ͘Ϭϰϰϵϵϭ Ϭ͘ϳϲϵϯϱϵ ϯ͘ϳϲϴϲϳϳ ϯ͘ϯϭϳϰϱϲ Ϭ͘ϬϬϵϭϴϱ Ϭ͘ϬϬϭϯϮϭ Ϭ͘ϬϬϬϮϰϴ^ĂŶDĂƚĞŽ ϮϬϮϱ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϯϴϲ͘ϱϵϮ ϴϴϯϭϰ͘ϵϳ ϴϴϯϭϰ͘ϵϳ Ϭ ϯϬϬϮϬ͘ϯϮ Ϭ͘ϲϲϱϴϰϯ ϭ͘ϰϱϭϭϱϳ Ϭ Ϭ͘ϬϮϬϳϬϳ Ϭ͘ϬϮϲϳϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϮϭϲϰϰ Ϭ͘ϬϮϴϬϬϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϵϭ ϳϯϮ͘Ϭϲϵϰ ϭϵϵ͘ϭϵϭ Ϭ Ϭ͘ϬϬϱϰϵ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϭϱϯϯϴ Ϭ͘Ϭϯϭϯϴϯ Ϭ Ϭ͘ϭϭϴϮϬϱ Ϭ͘ϭϬϵϳϲ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϯϰϱϲϵ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϯϴϭϯ Ϭ͘Ϯϲϰϵϲϯ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϲϵϯϳ Ϭ͘ϬϬϭϴϴϳ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϰϬ͘ϰϴϴϭϳ Ϯϭϰϱ͘ϮϮϰϬ Ϯϭϰϱ͘ϮϮϰ ϱϯϲ͘ϵϭϯϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϰϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ Dz ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϯϵϵϰ͘ϳϴ ϳϴϳϬϯ͘ϰϮ ϳϴϳϬϯ͘ϰϮ Ϭ Ϯϳϵϴϵ͘ϱϱ Ϭ͘ϱϬϱϰϮϭ Ϭ Ϭ͘ϭϭϳϲϳϯ Ϭ͘ϬϬϭϴϵϳ Ϭ Ϭ͘ϬϬϯϰϴϵ Ϭ͘ϬϬϭ Ϭ͘ϬϬϰϮ Ϭ͘ϬϬϮϬϯϭ Ϭ Ϭ͘ϬϬϯϳϭϵ Ϭ͘ϬϬϰ Ϭ͘ϬϭϮ ϭϴϲ͘ϰϮϴϭ Ϭ ϰϰ͘ϲϰϭϵϳ Ϭ͘ϭϰϬϴϭϴ Ϭ Ϭ͘ϭϲϲϰϲ Ϭ͘Ϭϯϲϰϭϵ ϬϬ͘ϬϬϳϭϭϭ Ϭ͘ϴϵϭϵϴϲ Ϭ ϭ͘ϮϭϵϮϰϮ ϯ͘ϱϰϴϬϲϳ ϯ͘ϳϬϭϯϭϱ ϯ͘ϭϱϰϴϲϴ ϭ͘Ϭϴϰϭϯϵ Ϭ ϭ͘ϯϮϱϴϴϯ ϯ͘ϱϰϴϬϲϳ ϯ͘ϳϬϭϯϭϱ ϯ͘ϭϱϰϴϲϴ Ϭ͘ϬϬϴϵϰϳ ϭϬ͘ϲϲϱϳϳ Ϭ ϳ͘ϲϵϭϰϴϯ Ϭ͘ϬϬϭϴϰϯ Ϭ Ϭ͘ϬϬϬϰϰϭ^ĂŶDĂƚĞŽ ϮϬϮϱ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϵϴϭϬ͘ϳϰ ϮϵϭϱϴϳϮ ϮϵϭϱϴϳϮ Ϭ ϰϮϵϰϱϵ͘ϳ Ϭ͘ϬϱϬϳϰϴ Ϭ Ϭ͘ϯϬϭϯϭϵ Ϭ͘ϬϬϭϭϬϰ Ϭ Ϭ͘ϬϬϭϴϳϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϰϯ Ϭ͘ϬϬϭϮϬ Ϭ͘ϬϬϮϬϯϱ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϯϴ ϯϴϯ͘ϳϱϳ Ϭ ϵϳ͘ϳϬϯϬϲ Ϭ͘ϬϬϮϮϭϵ Ϭ Ϭ͘ϬϳϰϴϮϱ Ϭ͘ϬϬϰϳϰϵϬ Ϭ͘Ϭϯϯϳϲ Ϭ͘ϬϬϴϲϳϭ Ϭ Ϭ͘ϯϱϲϳϭϮ Ϭ͘ϬϲϮϲϲϰ Ϭ͘ϭϲϵϯϱϭ ϭ͘Ϭϰϴϯϯϭ Ϭ͘ϬϭϮϲϱϮ Ϭ Ϭ͘ϯϵϬϱϱϱ Ϭ͘ϬϲϮϲϲϰ Ϭ͘ϭϲϵϯϱϭ ϭ͘Ϭϰϴϯϯϭ Ϭ͘ϬϯϵϮϴϴ Ϭ͘ϲϰϬϲϵϵ Ϭ ϯ͘ϮϮϱϴϯϱ Ϭ͘ϬϬϯϳϵϰ Ϭ Ϭ͘ϬϬϬϵϲϲ^ĂŶDĂƚĞŽ ϮϬϮϱ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϮϭϲ͘Ϯϭϯ ϯϴϮϮϮ͘ϱϱ ϯϴϮϮϮ͘ϱϱ Ϭ ϱϳϴϯ͘ϳϱϲ Ϭ͘Ϭϯϯϭϲϲ Ϭ Ϭ Ϭ͘ϬϬϯϲϲϲ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϬϳ Ϭ͘ϬϬϯϴϯϮ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϮϭ ϯϴϵ͘ϴϮϮϱ Ϭ Ϭ Ϭ͘ϬϬϬϯϵϱ Ϭ Ϭ Ϭ͘Ϭϲϭϰϭϳ Ϭ Ϭ Ϭ͘ϬϬϴϰϵϳϬϬϬϬϬϬ͘ϬϬϵϲϳϰ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϲϲϳϵϰ Ϭ Ϭ Ϭ͘ϬϬϯϲϵϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϴϮϰ͘ϵϳ ϱϮϰϬϴ͘ϯϮ Ϭ ϱϮϰϬϴ͘ϯϮ ϵϮϴϴ͘ϳϰϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϮϲ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϲϭϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϭϭϯϭ͘ϭϮϰ ϰϮϰϳϭ͘ϰϰ ϭϵϯϮϴ͘ϰϭ Ϯϯϭϰϯ͘Ϭϰ ϰϲϳϳ͘ϭϵϴ Ϭ͘ϬϬϮϵϮϰ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϲϮ Ϭ Ϭ͘ϬϬϭϳϭϱ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯϳ Ϭ͘ϬϬϬϱϬϮ Ϭ Ϭ͘ϬϬϭϴϲϱ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϮϭ ϭϮϮ͘ϴϮϳϰ ϬϵϬ͘ϱϰϮϱϭ Ϭ͘ϬϬϬϯϳϰ Ϭ Ϭ͘Ϭϰϭϴϵϲ Ϭ͘ϬϬϬϰϵϱ Ϭ Ϭ͘ϬϭϵϴϮϯ Ϭ͘ϬϬϭϮϮϵ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϳϱϮϰ Ϭ͘ϬϮϯϳϵϲ Ϭ͘Ϯϵϵϲϱϭ Ϭ͘ϬϬϭϳϵϯ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϳϱϮϰ Ϭ͘ϬϮϯϳϵϲ Ϭ͘Ϯϵϵϲϱϭ Ϭ͘Ϭϭϵϭϭϰ Ϭ͘ϭϴϯϰϵϯ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϭϰ Ϭ Ϭ͘ϬϬϬϴϵϱ^ĂŶDĂƚĞŽ ϮϬϮϱ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϯϬ͘ϱϰϬϭ ϴϬϱϯ͘ϭϳϳ ϴϬϱϯ͘ϭϳϳ Ϭ ϴϯ͘ϬϴϳϮϯ Ϭ͘ϮϲϴϯϬϰ Ϭ Ϭ͘ϰϬϬϰϵϯ Ϭ͘ϬϬϭϱϲϮ Ϭ Ϭ͘ϬϬϬϯϵϳ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϲϵϴ Ϭ Ϭ͘ϬϬϬϰϯϮ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϵϰϲ͘ϭϰϵ Ϭ ϯϭ͘ϯϯϭϭϰ Ϭ͘ϬϭϬϬϮϲ Ϭ Ϭ͘Ϭϯϲϭϭϱ Ϭ͘Ϭϭϵϭϴϰ Ϭ Ϭ͘Ϭϰϯϴϵϭ Ϭ͘ϬϰϬϲϲϲ Ϭ Ϭ͘ϭϰϳϲϵϵ ϴ͘ϰϱϮϱϱϳ Ϭ͘ϮϬϭϱϲϲ ϯ͘ϬϳϲϴϬϭ Ϭ͘Ϭϱϵϯϰ Ϭ Ϭ͘ϭϲϭϳϭϭ ϴ͘ϰϱϮϱϱϳ Ϭ͘ϮϬϭϱϲϲ ϯ͘ϬϳϲϴϬϭ Ϭ͘Ϭϰϰϵϰϯ Ϭ͘ϵϬϱϯϬϱ Ϭ ϯ͘ϯϮϬϭϮϯ Ϭ͘ϬϭϵϮϰϬ Ϭ͘ϬϬϬϯϭ^ĂŶDĂƚĞŽ ϮϬϮϱ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϯϴϰ͘ϱϭϮϱ ϯϴϲϯ͘ϮϮϮ ϯϴϲϯ͘ϮϮϮϬ ϯϴ͘ϰϱϭϮϱ Ϯ͘ϵϵϬϬϲϯ Ϭ Ϭ Ϭ͘Ϭϰϰϳϵϱ Ϭ Ϭ Ϭ͘ϬϬϰ Ϭ͘Ϭϭϱϲϳϱ Ϭ͘ϬϰϲϴϮ Ϭ Ϭ Ϭ͘Ϭϭϲ Ϭ͘Ϭϰϰϳϴϱ ϭϬϴϲ͘ϭϱϱ Ϭ Ϭ Ϭ͘ϬϬϰϭϬϲ Ϭ Ϭ Ϭ͘ϭϳϭϭϮϰ Ϭ Ϭ Ϭ͘ϬϴϴϯϵϲϬϬϬϬϬϬ͘ϭϬϬϲϯϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϵϰϳϱϵ Ϭ͘Ϯϳϯϵϱϲ Ϭ Ϭ Ϭ͘ϬϭϬϮϵϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϮϱ͘ϲϰϮϳ ϰϳϲϭϮ͘ϱϴ ϰϳϲϭϮ͘ϱϴ Ϭ ϭϲϱϭϵ͘ϰϲ Ϭ͘ϯϮϯϬϯϳ Ϭ͘Ϭϴϱϰϯϰ Ϭ͘ϰϮϬϰϳϮ Ϭ͘ϬϬϭϯϱϭ Ϭ Ϭ͘ϬϬϬϱϬϱ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϰϳ Ϭ Ϭ͘ϬϬϬϱϱ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϳϭϲ͘ϭϬϮ ϱϭϴ͘ϭϰϬϲ ϰϰ͘ϯϮϲϱϯ Ϭ͘ϬϭϬϰϮϱ Ϭ͘Ϯϲϳϰϯϰ Ϭ͘ϬϰϱϬϲ Ϭ͘ϬϭϳϰϮϰ Ϭ͘ϬϬϳϰϯϯ Ϭ͘Ϭϯϯϴϴϲ Ϭ͘ϬϱϬϬϲϮ ϭ͘ϬϭϳϳϮϱ Ϭ͘ϮϰϭϮϮϵ Ϭ͘ϬϮϲϳϯϮ Ϭ͘Ϯϭϴϯϰϱ Ϯ͘ϬϵϴϱϬϴ Ϭ͘ϬϳϯϬϱϭ ϭ͘ϰϴϱϬϲϯ Ϭ͘Ϯϲϰϭϭϲ Ϭ͘ϬϮϲϳϯϮ Ϭ͘Ϯϭϴϯϰϱ Ϯ͘ϬϵϴϱϬϴ Ϭ͘Ϭϰϰϵϵϱ ϭ͘ϬϭϳϮϬϯ ϭϱ͘ϭϳϰϲϰ ϱ͘ϮϴϲϬϲϵ Ϭ͘Ϭϭϲϵϲϱ Ϭ͘ϬϬϱϭϮϮ Ϭ͘ϬϬϬϰϯϴ^ĂŶDĂƚĞŽ ϮϬϮϱ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϮϵϰ͘ϵϭϳ ϭϳϳϱϱϳ͘ϴ ϭϳϳϱϱϳ͘ϴ Ϭ ϱϭϴϰϱ͘ϵϱ ϭ͘ϭϴϴϵϯϵ ϭϮ͘ϴϳϵϭϳ ϭ͘ϲϭϰϳϲϴ Ϭ͘Ϭϭϯϵϰϰ Ϭ͘ϬϮϳϲϳϱ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϵϴϮ Ϭ͘Ϭϭϰϱϳϱ Ϭ͘ϬϮϴϵϮϳ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϲϲϰ ϭϭϰϱ͘ϭϮϭ ϮϮϮϴ͘ϲϵϳ Ϭ Ϭ͘ϬϬϭϱϬϲ Ϭ͘ϬϭϭϮϳϲ Ϭ Ϭ͘ϭϴϬϰϭϰ Ϭ͘ϯϱϭϭϯϮ Ϭ Ϭ͘ϬϯϮϰϭϱ Ϭ͘ϮϰϮϳϳϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϯϲϵϬϮ Ϭ͘Ϯϳϲϯϳϲ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϭϬϯϲϴ Ϭ͘ϭϮϬϴϭϴ ϳ͘ϱϮϮϵϱϮ Ϭ Ϭ͘ϬϭϬϴϰϰ Ϭ͘ϬϮϭϭϬϰ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϰϭ͘ϰϵϱϳϰ ϮϰϬϳ͘ϳϵϯ ϬϮϰϬϳ͘ϳϵϯ ϱϴϯ͘ϰϭϭϴ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϬϳϵϱϭ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϳϭϲϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϰϰ͘ϰϰϰϵ ϮϬϱϰ͘Ϯϴϭ ϮϬϱϰ͘Ϯϴϭ Ϭ ϰϬϰ͘ϴϴϳϯ Ϭ͘ϭϭϵϯϴϯ ϲ͘ϱϮϴϱϬϭ Ϭ Ϭ͘ϬϬϭϮϵϲ Ϭ͘Ϭϭϵϯϳϲ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϲϬϵϰ Ϭ͘ϬϬϭϰϬϵ Ϭ͘ϬϮϭϬϳϯ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϵϴϮ ϵϵϳ͘ϭϵϲϰ ϱϰϮϵ͘ϳϮϵ Ϭ Ϭ͘ϳϳϲϰϲϲ ϭϲ͘ϵϲϳϰϮ Ϭ Ϭ͘ϮϬϯϮϴϱ ϭ͘ϭϬϲϴϴϲ Ϭ Ϭ͘ϬϭϭϬϵϰ Ϭ͘ϮϰϮϰϯϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϳϵϮϰϰ ϭϳ͘ϯϭϲϱ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘Ϭϲϱϳϱϰ ϯϳ͘ϰϳϴϭϭ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϮϱϮ͘ϳϮϮ ϭϯϳϭϱ͘ϬϮ ϭϯϳϭϱ͘ϬϮ Ϭ ϱϬϱϲ͘ϰϲϮ Ϭ͘ϮϱϰϮϴϵ Ϭ͘Ϭϲϯϲϭϵ Ϭ͘ϯϲϰϴϭϯ Ϭ͘ϬϬϭϬϱ Ϭ Ϭ͘ϬϬϬϮϴϵ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϲϴ Ϭ͘ϬϬϭϭϰϮ Ϭ Ϭ͘ϬϬϬϯϭϰ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϳϵϵ ϭϳϬϰ͘ϵϯϲ ϯϲϴ͘Ϭϰϲϲ Ϯϵ͘ϲϵϴϰϭ Ϭ͘ϬϬϳϴϰϮϬ͘ϮϬϰϴϳϰ Ϭ͘ϬϯϮϮϴϴ Ϭ͘Ϭϭϰϵϳϱ Ϭ͘ϬϬϱϳϲϮ Ϭ͘Ϭϯϭϯϴϰ Ϭ͘ϬϯϲϰϮϱ Ϭ͘ϳϰϳϬϵϯ Ϭ͘ϭϱϵϵϵϵ Ϭ͘ϬϮϱϴϮϮ Ϭ͘ϭϭϲϮϰϳ ϭ͘ϵϳϯϴϱϳ Ϭ͘ϬϱϯϭϱϮ ϭ͘ϬϵϬϭϱϳ Ϭ͘ϭϳϱϭϳϵ Ϭ͘ϬϮϱϴϮϮ Ϭ͘ϭϭϲϮϰϳ ϭ͘ϵϳϯϴϱϳ Ϭ͘Ϭϰϰϵϰϴ Ϭ͘ϳϳϳϮϮϳ ϱ͘ϳϳϵϱϴϴ ϯ͘ϯϰϬϲϭϰ Ϭ͘Ϭϭϲϴϱϱ Ϭ͘ϬϬϯϲϯϵ Ϭ͘ϬϬϬϮϵϰ^ĂŶDĂƚĞŽ ϮϬϮϱ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϭϭϭ͘ϱϳϲ ϳϱϯϬϱ͘ϭϯ ϳϱϯϬϱ͘ϭϯ Ϭ ϭϬϴϴϵ͘ϰϱ Ϭ͘ϴϭϮϭϱϱ ϱ͘ϱϵϰϳϱϴ ϭ͘ϰϵϳϱ Ϭ͘ϬϬϵϮϱϮ Ϭ͘ϬϬϯϭϴϴ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϳϯϴ Ϭ͘ϬϬϵϲϳϭ Ϭ͘ϬϬϯϯϯϮ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϵϲϱϳ ϭϮϮϳ͘ϴϮϳ ϭϮϬϵ͘ϴϴϳ Ϭ Ϭ͘ϬϬϬϵϭϱ Ϭ͘Ϭϭϰϭϲϭ ϬϬ͘ϭϵϯϰϰϱ Ϭ͘ϭϵϬϲϭϴ Ϭ Ϭ͘Ϭϭϵϲϵϲ Ϭ͘ϯϬϰϴϴϴϬϬϬϬϬ͘ϬϮϮϰϮϮ Ϭ͘ϯϰϳϬϵϮ Ϭ Ϭ Ϭ Ϭ Ϭ͘Ϯϭϳϴϲϳ Ϭ͘ϬϵϮϱϰϲ ϱ͘ϲϵϭϴϲ Ϭ Ϭ͘ϬϭϭϲϮϳ Ϭ͘Ϭϭϭϰϱϳ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯ͘ϭϰϯϵϰϵ ϭϴϱ͘ϱϱϯϲ Ϭϭϴϱ͘ϱϱϯϲ ϰϮ͘ϴϵϲϭϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϬϳϴϰ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϯϵϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϵ͘ϭϴϰϭϰ ϱϴϰ͘ϳϴϲϴ ϱϴϰ͘ϳϴϲϴ Ϭ ϴϭ͘ϳϯϴϴϱ Ϭ͘ϭϲϱϰϱϳ ϭ͘ϱϮϵϱϳϵ Ϭ Ϭ͘ϬϬϭϭϳϴ Ϭ͘ϬϬϰϬϴϲ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϲϭϰϴ Ϭ͘ϬϬϭϮϴϮ Ϭ͘ϬϬϰϰϰϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϲϭϯϳ ϵϵϭ͘ϱϵϭϲ ϭϭϵϱ͘Ϭϯϯ Ϭ Ϭ͘ϴϬϯϯϲϴ ϰ͘ϭϰϬϭϲϰ Ϭ Ϭ͘ϮϬϮϭϰϮ Ϭ͘Ϯϰϯϲϭϱ Ϭ Ϭ͘Ϭϭϭϰϳϵ Ϭ͘ϬϱϵϭϱϱϬϬϬϬϬ͘ϴϭϵϴϵϲ ϰ͘ϮϮϱϯϰϭ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘ϮϵϬϴϴϵ ϳ͘ϳϳϰϰϭϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϭ͘ϯϳϭϯϱ ϯϲϳϵ͘ϳϴϭ ϯϲϳϵ͘ϳϴϭ Ϭ Ϯϴϱ͘ϰϴϱϰ Ϭ͘ϳϲϳϮϰϮ Ϭ͘ϴϴϯϯϭϵ Ϭ͘ϲϮϲϰϳϭ Ϭ͘ϬϬϭϭϮϵ Ϭ Ϭ͘ϬϬϬϳϮϰ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϭϮϮϴ Ϭ Ϭ͘ϬϬϬϳϴϳ Ϭ͘ϬϬϴ Ϭ͘Ϭϰϰϵϭϳ ϳϴϮ͘ϮϮϴϵ Ϯϰϵϵ͘ϳϳϱ ϱϵ͘ϴϬϬϵϳ Ϭ͘Ϭϭϳϲϵϭ Ϯ͘ϰϰϲϱϬϲ Ϭ͘Ϭϴϱϯϴϭ Ϭ͘ϬϯϲϮϵϲ Ϭ͘ϬϴϮϯϱϴ Ϭ͘Ϭϱϲϰϰϱ Ϭ͘Ϭϴϲϲϱϴ ϭϬ͘ϲϭϮϰϴ Ϭ͘ϰϵϰϵϰϴ Ϭ͘ϭϮϮϲϭϴ Ϭ͘ϯϲϮϴϯϵ ϭ͘ϵϬϳϳϱϮ Ϭ͘ϭϮϲϰϱϮ ϭϱ͘ϰϴϱϳ Ϭ͘ϱϰϭϵϬϲ Ϭ͘ϭϮϮϲϭϴ Ϭ͘ϯϲϮϴϯϵ ϭ͘ϵϬϳϳϱϮ Ϭ͘Ϭϰϱ Ϯ͘Ϯϭϲϱϱϲ ϴϮ͘Ϭϲϰϱϰ ϭϮ͘ϮϬϲϱϰ Ϭ͘ϬϬϳϳϯϯ Ϭ͘ϬϮϰϳϭϯ Ϭ͘ϬϬϬϱϵϭ^ĂŶDĂƚĞŽ ϮϬϮϱ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϲϴ͘ϵϯϵϳ ϯϳϱϴ͘Ϯϰ ϯϳϱϴ͘ϮϰϬ Ϯϰϰϲ͘Ϯϰϳ ϰ͘ϯϴϳϳϵϳ ϮϮ͘ϯϵϬϳϭ Ϭ͘ϰϳϲϴϴϲ Ϭ͘ϬϮϬϵϭϯ Ϭ͘ϬϮϭϳϭϯ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭϬ͘ϬϮϭϴϱϴ Ϭ͘ϬϮϮϲϵϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϭϯϴ͘ϴϴϭ ϮϮϮϱ͘ϲϳϵ Ϭ Ϭ͘ϬϬϮϵϴϲ Ϭ͘ϬϬϴϭϮ ϬϬ͘ϭϳϵϰϯϭ Ϭ͘ϯϱϬϲϱϳ Ϭ Ϭ͘ϬϲϰϮϴϯ Ϭ͘ϭϳϰϴϭϴϬϬϬϬϬ͘ϬϳϯϭϴϮ Ϭ͘ϭϵϵϬϭϳ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϰϰϯϱϯ Ϭ͘ϭϵϱϴϰ ϰ͘ϱϰϴϵϰϰ Ϭ Ϭ͘ϬϭϬϳϴϱ Ϭ͘ϬϮϭϬϳϲ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭ͘ϵϴϰϴϵϰ ϳϴ͘ϴϵϭϬϱ Ϭϳϴ͘ϴϵϭϬϱ ϭϳ͘ϳϵϴϲϬϬϬϬϬϬϬ͘ϬϬϮϯϭϴ Ϭ͘ϬϬϳϴϲ Ϭ Ϭ Ϭ Ϭ͘ϬϬϵϮϳ Ϭ͘ϬϮϮϰϱϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲ͘ϱϱϮϳϵϵ ϭϲϯ͘ϲϮϵϱ ϭϲϯ͘ϲϮϵϱ Ϭ ϵϰ͘ϴϴϰϱϰ Ϭ͘ϱϭϱϲϱϲ ϱ͘Ϯϯϵϲϭϱ Ϭ Ϭ͘ϬϬϯϯϳϴ Ϭ͘ϬϭϮϭϬϯ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϯϲϳϰ Ϭ͘Ϭϭϯϭϲϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϮϯϳ͘ϰϲ ϰϬϵϲ͘ϮϮ Ϭ ϯ͘Ϯϵϲϯϱϲ ϭϰ͘ϴϳϬϰϰ Ϭ Ϭ͘ϮϱϮϮϲϰ Ϭ͘ϴϯϱϬϰϭ Ϭ Ϭ͘ϬϰϳϬϵϴ Ϭ͘ϮϭϮϰϲϵϬϬϬϬϯ͘ϯϲϰϭϳϯ ϭϱ͘ϭϳϲϯϴ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϭϬ͘ϵϴϴϳ ϮϮ͘ϰϮϵϮ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϭ͘ϲϮϱϱϳ ϰϭϵϬ͘ϯϰϰ ϰϭϵϬ͘ϯϰϰ Ϭ Ϯϰϲ͘ϱϬϮϯ Ϭ͘Ϭϯϳϯϴ Ϭ Ϭ͘ϰϵϮϭϭϳ Ϭ͘ϬϬϭϭϬϱ Ϭ Ϭ͘ϬϬϬϭϱϭ Ϭ͘ϬϬϮϬϳϯ Ϭ͘ϬϯϮϯϯϯ Ϭ͘ϬϬϭϮϬϮ Ϭ Ϭ͘ϬϬϬϭϲϰ Ϭ͘ϬϬϴϮϵ Ϭ͘ϬϵϮϯϳϵ ϵϵϱ͘ϯϬϮϳ Ϭ ϰϬ͘ϭϭϳϭϮ Ϭ͘ϬϬϮϬϰϯ Ϭ Ϭ͘ϬϰϲϬϳϭ Ϭ͘ϬϬϰϵϭ Ϭ Ϭ͘Ϭϲϴϲϭ Ϭ͘ϬϬϱϵϭϭ Ϭ Ϭ͘ϭϳϯϬϮ Ϭ͘Ϭϱϳϳϯ Ϭ͘ϭϭϵϴϵϴ Ϭ͘ϲϭϴϰϮϮ Ϭ͘ϬϬϴϲϮϱ Ϭ Ϭ͘ϭϴϵϰϯϱ Ϭ͘Ϭϱϳϳϯ Ϭ͘ϭϭϵϴϵϴ Ϭ͘ϲϭϴϰϮϮ Ϭ͘Ϭϰϱ Ϭ͘ϱϲϮϯϬϯ Ϭ ϲ͘Ϯϭϴϰϱϵ Ϭ͘ϬϬϵϴϰ ϬϬ͘ϬϬϬϯϵϳ^ĂŶDĂƚĞŽ ϮϬϮϱ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϳϴ͘Ϯϭϴϱ ϮϭϱϮϲ͘ϴϯ ϮϭϱϮϲ͘ϴϯ Ϭ ϭϭϭϮ͘ϴϳϰ Ϭ͘ϯϳϱϱϱϯ Ϭ Ϭ Ϭ͘ϬϬϲϴϮϳ Ϭ Ϭ Ϭ͘ϬϬϴϬϵϳ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϳϭϯϲ Ϭ Ϭ Ϭ͘ϬϯϮϯϴϳϬ͘ϭϭ ϭϮϮϯ͘ϲϬϲ Ϭ Ϭ Ϭ͘ϬϬϯϭϰϱ Ϭ Ϭ Ϭ͘ϭϵϮϳϴ Ϭ Ϭ Ϭ͘ϬϲϳϳϭϳϬϬϬϬϬϬ͘ϬϳϳϬϵϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϮ Ϭ͘Ϭϳϳϭϵϯ Ϭ Ϭ Ϭ͘Ϭϭϭϱϵϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϱ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯϳ͘ϯϭϳϰϴ ϯϴϳϬ͘ϱϯϴ ϬϯϴϳϬ͘ϱϯϴ ϭϰϵ͘ϮϲϵϵϬϬϬϬϬϬϬ͘ϬϬϳϯϲϵ Ϭ͘ϬϭϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϮϵϰϳϰ Ϭ͘ϬϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϱ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲϱ͘ϱϭϱϰ ϰϱϯϰ͘ϯϵϭ ϰϱϯϰ͘ϯϵϭ Ϭ ϮϲϮ͘Ϭϲϭϲ Ϭ͘Ϭϱϱϰϯϯ Ϭ Ϭ Ϭ͘ϬϬϬϮϳϮ Ϭ Ϭ Ϭ͘ϬϬϳϳϰϮ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϬϮϴϱ Ϭ Ϭ Ϭ͘ϬϯϬϵϲϴ Ϭ͘ϭϭ ϭϮϲϮ͘ϳϰϳ Ϭ Ϭ ϰ͘ϭϬϬϴϵϮ Ϭ Ϭ Ϭ͘Ϯϱϳϰϭϵ Ϭ Ϭ Ϭ͘ϬϱϴϱϵϰϬϬϬϬϬϰ͘ϭϴϱϮϲϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϵϳ ϰϲ͘ϱϭϮϲϯ Ϭ Ϭ Ϭ Ϭ Ϭ ^ŽƵƌĐĞ͗D&ϮϬϮϭ;ǀϭ͘Ϭ͘ϮͿŵŝƐƐŝŽŶZĂƚĞƐZĞŐŝŽŶdǇƉĞ͗ŽƵŶƚǇZĞŐŝŽŶ͗^ĂŶDĂƚĞŽĂůĞŶĚĂƌzĞĂƌ͗ϮϬϮϲ^ĞĂƐŽŶ͗ŶŶƵĂůsĞŚŝĐůĞůĂƐƐŝĨŝĐĂƚŝŽŶ͗D&ϮϬϬϳĂƚĞŐŽƌŝĞƐhŶŝƚƐ͗ŵŝůĞƐͬĚĂǇĨŽƌsDdĂŶĚsDd͕ƚƌŝƉƐͬĚĂǇĨŽƌdƌŝƉƐ͕ŐͬŵŝůĞĨŽƌZhEy͕WDtĂŶĚWDdt͕ŐͬƚƌŝƉĨŽƌ^dZy͕,Kd^K<ĂŶĚZhE>K^^͕ŐͬǀĞŚŝĐůĞͬĚĂǇĨŽƌ/>yĂŶĚ/hZE͘W,sĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŽƚĂůsDd͘ZĞŐŝŽŶ ĂůĞŶĚĂƌz sĞŚŝĐůĞĂƚDŽĚĞůzĞĂ ^ƉĞĞĚ &ƵĞů WŽƉƵůĂƚŝŽŶdŽƚĂůsDd sDd sDd dƌŝƉƐ EKǆͺZhEEKǆͺ/>yEKǆͺ^dZyWDϮ͘ϱͺZh WDϮ͘ϱͺ/>WDϮ͘ϱͺ^dZWDϮ͘ϱͺWDWDϮ͘ϱͺWDWDϭϬͺZhEWDϭϬͺ/>WDϭϬͺ^dZ WDϭϬͺWDdWDϭϬͺWDKϮͺZhEKϮͺ/>yKϮͺ^dZy,ϰͺZhE,ϰͺ/>y,ϰͺ^dZyEϮKͺZhEEϮKͺ/>yEϮKͺ^dZyZK'ͺZhEZK'ͺ/>yZK'ͺ^dZyZK'ͺ,Kd^ZK'ͺZhE>ZK'ͺ/hZdK'ͺZhEdK'ͺ/>ydK'ͺ^dZydK'ͺ,Kd^dK'ͺZhE>dK'ͺ/hZ E,ϯͺZhEKͺZhEyKͺ/>y Kͺ^dZy ^KǆͺZhE ^Kǆͺ/>y ^Kǆͺ^dZy^ĂŶDĂƚĞŽ ϮϬϮϲ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϰ͘Ϯϴϯϴϵϴ ϱϬϰ͘ϯϴϵϵ ϱϬϰ͘ϯϴϵϵ Ϭ ϴϱ͘ϳϭϮϮϯ ϯ͘ϳϲϳϭϮϴ Ϭ Ϭ͘ϬϬϭϵϮϴ Ϭ͘ϬϬϭϯϲϯ Ϭ Ϭ͘ϬϬϬϲϯϰ Ϭ͘ϬϬϱ Ϭ͘ϬϯϭϬϯϵ Ϭ͘ϬϬϭϰϴϮ Ϭ Ϭ͘ϬϬϬϲϵ Ϭ͘ϬϮ Ϭ͘ϬϴϴϲϴϮ ϮϮϬϲ͘ϴϬϵ Ϭ ϱϭ͘Ϭϯϴϲϵ Ϭ͘ϭϬϵϭϵϲ Ϭ ϵ͘ϴϴͲϬϱ Ϭ͘ϭϰϳϮϲϰ Ϭ Ϭ͘ϬϬϬϭ Ϭ͘ϱϯϲϬϮ Ϭ Ϭ͘ϬϬϬϱϯϲ Ϭ͘ϬϮϵϯϮϮ Ϭ͘ϮϭϮϵϰϴ ϭ͘ϵϬϱϰϯϰ Ϭ͘ϳϴϮϭϱϵ Ϭ Ϭ͘ϬϬϬϱϴϳ Ϭ͘ϬϮϵϯϮϮ Ϭ͘ϮϭϮϵϰϴ ϭ͘ϵϬϱϰϯϰ Ϭ͘Ϭϰϱ ϯϯ͘ϯϯϳϭϰ Ϭ ϰ͘ϲϳϵϳϳϵ Ϭ͘ϬϮϭϴϭϳ Ϭ Ϭ͘ϬϬϬϱϬϱ^ĂŶDĂƚĞŽ ϮϬϮϲ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϯϯϵ͘ϭϮϭ ϭϭϵϱϵϭ͘ϳ ϭϭϵϱϵϭ͘ϳ Ϭ ϭϰϴϯϲ͘ϰϵ Ϯ͘ϱϭϯϯϭϲ ϰϰ͘ϯϵϭϳϳ ϯ͘ϬϰϮϲϴϯ Ϭ͘ϬϮϰϯϯϰ Ϭ͘ϬϯϬϵϴϴ Ϭ Ϭ͘ϬϬϴϲϬϳ Ϭ͘ϬϯϬϮϳϮ Ϭ͘ϬϮϱϰϯϰ Ϭ͘ϬϯϮϯϴϵ Ϭ Ϭ͘ϬϯϰϰϮϲ Ϭ͘ϬϴϲϰϵϮ ϭϳϱϮ͘ϵϵϭ ϴϬϰϰ͘ϴϴϲ Ϭ Ϭ͘ϬϬϭϭϲ Ϭ͘ϭϱϴϵϮϭ Ϭ Ϭ͘Ϯϳϲϭϴϱ ϭ͘Ϯϲϳϰϳϱ Ϭ Ϭ͘ϬϮϰϵϲϰ ϯ͘ϰϮϭϱϯϲϬϬϬϬϬ͘ϬϮϴϰϮ ϯ͘ϴϵϱϭϱϴϬϬϬϬϬ͘ϮϬϮϱϱϲ Ϭ͘ϭϬϴϰϬϳ ϰϴ͘ϮϱϭϰϮ Ϭ Ϭ͘Ϭϭϲϲ Ϭ͘Ϭϳϲϭϴ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϳ͘ϮϰϬϵϮ ϭϱϲϴ͘ϱϳϵ Ϭϭϱϲϴ͘ϱϳϵ ϭϲϳ͘ϲϬϵϳϬϬϬϬϬϬϬ͘ϬϬϴϰϵϵ Ϭ͘ϬϭϳϮϳϳ Ϭ Ϭ Ϭ Ϭ͘Ϭϯϯϵϵϰ Ϭ͘ϬϰϵϯϲϰϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϵϬ͘ϲϬϳϳ ϭϮϯϴϴ͘ϰϰ ϭϮϯϴϴ͘ϰϰ Ϭ ϭϮϱϯ͘ϲϱϰ ϭ͘ϭϵϵϲϰϮ ϴ͘ϯϬϰϱϯϵ Ϭ Ϭ͘ϬϬϭϲϭϰ Ϭ͘ϬϭϮϮϬϴ Ϭ Ϭ͘ϬϬϵ Ϭ͘ϬϲϬϴϵ Ϭ͘ϬϬϭϳϱϱ Ϭ͘ϬϭϯϮϳϳ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϭϳϯϵϳ ϭϰϱϮ͘ϰϵϱ ϴϮϭϲ͘ϯϵϲ Ϭ Ϯ͘ϱϱϳϱϯϴ Ϯϭ͘ϮϮϱϴϳ Ϭ Ϭ͘ϮϵϲϭϬϭ ϭ͘ϲϳϰϵϲϲ Ϭ Ϭ͘ϬϱϰϳϬϭ Ϭ͘ϯϯϰϵϵϲϬϬϬϬϮ͘ϲϯϬϴϰϰ Ϯϭ͘ϲϵϴϲϵϬϬϬϬϬ͘ϳϭϯϭϱϴ ϭϱ͘ϭϯϯϴϲ ϲϭ͘ϲϱϯϵ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϯϴϲϭϳ͘ϴ ϲϵϲϵϬϰϳ ϲϵϲϵϬϰϳ Ϭ ϭϭϭϵϱϵϮ Ϭ͘Ϭϯϭϴϭϱ Ϭ Ϭ͘ϮϮϱϱϵϮ Ϭ͘ϬϬϭϬϴ Ϭ Ϭ͘ϬϬϭϴϰϲ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϰϵ Ϭ͘ϬϬϭϭϳϰϬ Ϭ͘ϬϬϮϬϬϳ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϳϭ Ϯϱϵ͘ϲϬϭϴ Ϭ ϲϱ͘ϳϰϯϭϴ Ϭ͘ϬϬϭϲϳϰ Ϭ Ϭ͘ϬϲϬϬϲϯ Ϭ͘ϬϬϯϴϬϲϬ Ϭ͘ϬϮϵϮϬϲ Ϭ͘ϬϬϲϮϲϮ Ϭ Ϭ͘Ϯϳϳϭϯϱ Ϭ͘ϬϳϳϬϯϲ Ϭ͘ϮϬϭϭϲϮ ϭ͘ϮϬϱϳϭϳ Ϭ͘ϬϬϵϭϯϴ Ϭ Ϭ͘ϯϬϯϰϮϴ Ϭ͘ϬϳϳϬϯϲ Ϭ͘ϮϬϭϭϲϮ ϭ͘ϮϬϱϳϭϳ Ϭ͘ϬϯϳϲϮϱ Ϭ͘ϱϳϮϲϳϰ Ϭ Ϯ͘ϴϱϳϵϱϯ Ϭ͘ϬϬϮϱϲϲ Ϭ Ϭ͘ϬϬϬϲϱ^ĂŶDĂƚĞŽ ϮϬϮϲ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲϰϱ͘Ϭϲϲϰ ϭϯϱϭϭ͘Ϯϳ ϭϯϱϭϭ͘Ϯϳ Ϭ ϮϳϬϰ͘ϳϵϳ Ϭ͘ϭϰϰϴϬϯ Ϭ Ϭ Ϭ͘ϬϭϬϬϲϴ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϰϭϰ Ϭ͘ϬϭϬϱϮϯ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϴϵϳ ϮϮϳ͘Ϭϳϭϭ Ϭ Ϭ Ϭ͘ϬϬϬϴϴϮ Ϭ Ϭ Ϭ͘Ϭϯϱϳϳϱ Ϭ Ϭ Ϭ͘ϬϭϴϵϴϬϬϬϬϬϬ͘ϬϮϭϲϬϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϮϴϬϮϲϱ Ϭ Ϭ Ϭ͘ϬϬϮϭϱϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϮϬϲϮϳ͘ϲϰ ϳϱϭϲϱϳ͘ϰ Ϭ ϳϱϭϲϱϳ͘ϰ ϭϬϭϲϬϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϯϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϴϰϯϰ͘ϰϳϭ ϮϴϰϬϲϬ͘Ϯ ϭϯϮϱϯϵ͘ϵ ϭϱϭϱϮϬ͘ϯ ϯϰϴϳϲ͘ϱϰ Ϭ͘ϬϬϮϵϵϴ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϱϭ Ϭ Ϭ͘ϬϬϭϴϯϵ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯϰ Ϭ͘ϬϬϬϱϱϱ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϭϯ ϭϮϱ͘ϵϭϴϲ Ϭ ϲϮ͘ϯϯϵϰϮ Ϭ͘ϬϬϬϯϴ Ϭ Ϭ͘Ϭϰϭϰϱϭ Ϭ͘ϬϬϬϰϵϳ Ϭ Ϭ͘ϬϭϵϰϬϵ Ϭ͘ϬϬϭϮϲ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘Ϭϯϳϱϵϴ Ϭ͘ϬϯϰϬϵϱ Ϭ͘ϯϴϴϱϯϱ Ϭ͘ϬϬϭϴϯϴ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘Ϭϯϳϱϵϴ Ϭ͘ϬϯϰϬϵϱ Ϭ͘ϯϴϴϱϯϱ Ϭ͘ϬϭϴϴϱϵϬ͘ϭϴϴϬϲϴ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϰϱ Ϭ Ϭ͘ϬϬϬϲϭϲ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϱϵϰϱ͘ϳϵ ϳϭϳϯϮϲ͘ϲ ϳϭϳϯϮϲ͘ϲ Ϭ ϭϭϴϵϴϵ͘ϵ Ϭ͘ϬϳϴϬϭϲ Ϭ Ϭ͘ϮϵϯϮϱϰ Ϭ͘ϬϬϭϯϯϰ Ϭ Ϭ͘ϬϬϮϭϱϱ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϭϴ Ϭ͘ϬϬϭϰϱϭ Ϭ Ϭ͘ϬϬϮϯϰϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϱϮ ϯϬϰ͘ϬϬϳϲ Ϭ ϳϴ͘ϲϭϲϰϰ Ϭ͘ϬϬϯϲϯϵ Ϭ Ϭ͘Ϭϳϳϭϲϲ Ϭ͘ϬϬϲϯϬϵ Ϭ Ϭ͘ϬϯϮϱϴϲ Ϭ͘Ϭϭϱϳϱϲ Ϭ Ϭ͘ϯϴϮϲϳϭ Ϭ͘ϭϭϯϲϱϯ Ϭ͘ϯϭϰϴϯϴ ϭ͘ϳϵϰϵϬϲ Ϭ͘ϬϮϮϵϵϭ Ϭ Ϭ͘ϰϭϴϵϳϲ Ϭ͘ϭϭϯϲϱϯ Ϭ͘ϯϭϰϴϯϴ ϭ͘ϳϵϰϵϬϲ Ϭ͘Ϭϯϴϰϯϳ Ϭ͘ϵϭϭϮϮϲ Ϭ ϯ͘ϴϵϴϯϲϭ Ϭ͘ϬϬϯϬϬϱ Ϭ Ϭ͘ϬϬϬϳϳϳ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϱ͘ϳϯϭϯϵϵ ϲϲ͘ϬϵϵϬϲ ϲϲ͘ϬϵϵϬϲ Ϭ ϭϱ͘ϴϭϴϰϭ ϭ͘ϲϬϳϰϰϯ Ϭ Ϭ Ϭ͘ϮϮϵϱϯ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϯϯϬϯ Ϭ͘ϮϯϵϵϬϴ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϰϯϴ ϰϭϱ͘ϮϬϯϳ Ϭ Ϭ Ϭ͘Ϭϭϰϭϰ Ϭ Ϭ Ϭ͘Ϭϲϱϰϭϲ Ϭ Ϭ Ϭ͘ϯϬϰϰϮϰϬϬϬϬϬϬ͘ϯϰϲϱϲϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ ϭ͘ϲϭϵϲϳϮ Ϭ Ϭ Ϭ͘ϬϬϯϵϯϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϰϭ͘ϵϴϮϮ ϱϭϲϬ͘ϭϰϳ ϬϱϭϲϬ͘ϭϰϳ ϲϵϳ͘Ϭϳϭϲ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϰϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϭϬϰ͘ϳϰϰϯ ϯϴϯϳ͘ϭϰϲ ϭϲϯϱ͘ϵϴϳ ϮϮϬϭ͘ϭϱϵ ϰϯϯ͘ϭϭϳϱ Ϭ͘ϬϬϮϳϯϵ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϯ Ϭ Ϭ͘ϬϬϭϯϬϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϵ Ϭ͘ϬϬϬϯϱϵ Ϭ Ϭ͘ϬϬϭϰϮϯ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϱϰ ϭϭϱ͘Ϭϳϴϳ Ϭ ϲϲ͘ϳϲϯϬϭ Ϭ͘ϬϬϬϯϰϳ Ϭ Ϭ͘ϬϰϭϰϮϱ Ϭ͘ϬϬϬϰϱϯ Ϭ Ϭ͘Ϭϭϵϯϴϱ Ϭ͘ϬϬϭϭϱϭ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϯϮϵ Ϭ͘ϬϭϵϵϮϳ Ϭ͘Ϯϲϱϰϱϴ Ϭ͘ϬϬϭϲϴ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϯϮϵ Ϭ͘ϬϭϵϵϮϳ Ϭ͘Ϯϲϱϰϱϴ Ϭ͘ϬϭϳϵϬϳ Ϭ͘ϭϳϭϵϰϮ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϯϴ Ϭ Ϭ͘ϬϬϬϲϲ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϲϵϲϵϳ͘ϳ ϱϮϬϲϲϵϰ ϱϮϬϲϲϵϰ Ϭ ϴϭϯϳϮϰ͘Ϯ Ϭ͘Ϭϯϵϱϲϰ Ϭ Ϭ͘Ϯϰϲϰϭϱ Ϭ͘ϬϬϭϬϲϭ Ϭ Ϭ͘ϬϬϭϳϱϲ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϯϮ Ϭ͘ϬϬϭϭϱϰ Ϭ Ϭ͘ϬϬϭϵϬϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϬϲ ϯϭϬ͘ϵϮϭϮ Ϭ ϳϴ͘ϲϭϯϲϱ Ϭ͘ϬϬϭϴϯϲ Ϭ Ϭ͘ϬϲϮϲϭϱ Ϭ͘ϬϬϰϭϰϱ Ϭ Ϭ͘ϬϯϭϬϱϴ Ϭ͘ϬϬϲϳϳϮ Ϭ Ϭ͘ϮϴϬϭϵϴ Ϭ͘Ϭϱϯϲϴϰ Ϭ͘ϭϰϬϬϯϴ Ϭ͘ϴϳϳϳϲϲ Ϭ͘ϬϬϵϴϴϭ ϬϬ͘ϯϬϲϳϴϮ Ϭ͘Ϭϱϯϲϴϰ Ϭ͘ϭϰϬϬϯϴ Ϭ͘ϴϳϳϳϲϲ Ϭ͘Ϭϯϵϱϵϲ Ϭ͘ϱϵϭϮϬϱ Ϭ Ϯ͘ϵϮϬϲϮϮ Ϭ͘ϬϬϯϬϳϰ Ϭ Ϭ͘ϬϬϬϳϳϳ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲϱϱ͘ϭϲϵϲ ϭϵϴϱϯ͘ϰϮ ϭϵϴϱϯ͘ϰϮ Ϭ ϯϭϯϵ͘ϰϳϴ Ϭ͘Ϭϯϯϱϰϴ Ϭ Ϭ Ϭ͘ϬϬϰϬϳϵ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϱϭ Ϭ͘ϬϬϰϮϲϰ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϲ Ϯϴϵ͘ϯϰϵϯ Ϭ Ϭ Ϭ͘ϬϬϬϱϱϱ Ϭ Ϭ Ϭ͘Ϭϰϱϱϴϳ Ϭ Ϭ Ϭ͘ϬϭϭϵϱϮϬϬϬϬϬϬ͘ϬϭϯϲϬϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϭϲϯϰ Ϭ Ϭ Ϭ͘ϬϬϮϳϰϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯϭϯϵ͘ϵϲϮ ϱϴϳϵϰ͘ϬϮ Ϭϱϴϳϵϰ͘ϬϮ ϭϬϴϯϲ͘ϭϴ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϴ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϲϰϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϮϯϯϬ͘ϳϯϳ ϴϭϬϵϯ͘Ϭϱ ϯϲϭϰϱ͘Ϭϵ ϰϰϵϰϳ͘ϵϲ ϵϲϯϳ͘ϱϵϲ Ϭ͘ϬϬϮϴϲϰ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϵϱ Ϭ Ϭ͘ϬϬϭϰϵϳ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϮ Ϭ͘ϬϬϬϰϯ Ϭ Ϭ͘ϬϬϭϲϮϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϯϱ ϭϮϬ͘Ϯϵϳϯ Ϭ ϳϮ͘ϳϵϭϮϴ Ϭ͘ϬϬϬϯϲϮ Ϭ Ϭ͘Ϭϰϭϯϴϴ Ϭ͘ϬϬϬϰϳϯ Ϭ Ϭ͘Ϭϭϵϯϱ Ϭ͘ϬϬϭϮϬϰ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϰϵϭϳ Ϭ͘ϬϮϮϱϭϴ Ϭ͘ϮϴϲϬϴϱ Ϭ͘ϬϬϭϳϱϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϰϵϭϳ Ϭ͘ϬϮϮϱϭϴ Ϭ͘ϮϴϲϬϴϱ Ϭ͘Ϭϭϴϳϭϭ Ϭ͘ϭϳϵϳϬϳ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϴϵ Ϭ Ϭ͘ϬϬϬϳϮ^ĂŶDĂƚĞŽ ϮϬϮϲ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϮϬϵϭ͘Ϯϳ ϰϬϵϯϳϵ͘ϳ ϰϬϵϯϳϵ͘ϳ Ϭ ϭϴϬϭϰϭ͘ϵ Ϭ͘ϬϴϮϬϳϴ Ϭ͘Ϭϯϭϱϴϭ Ϭ͘ϱϮϱϮϬϳ Ϭ͘ϬϬϭϯϮϰ Ϭ Ϭ͘ϬϬϬϭϵϳ Ϭ͘ϬϬϮ Ϭ͘ϬϮϳϯ Ϭ͘ϬϬϭϰϰ Ϭ Ϭ͘ϬϬϬϮϭϰ Ϭ͘ϬϬϴ Ϭ͘Ϭϳϴ ϴϭϭ͘ϵϵϬϭ ϭϭϰ͘ϯϲϰϵ Ϯϲ͘Ϯϳϭϳϵ Ϭ͘ϬϬϰϯϮϳ Ϭ͘ϭϬϭϮϭϭ Ϭ͘ϬϮϲϬϳϯ Ϭ͘ϬϬϰϳϳϭ Ϭ͘ϬϬϮϳϴ Ϭ͘Ϭϰϱϭϰϰ Ϭ͘ϬϮϬϲϳϲ Ϭ͘ϯϲϮϭϴϴ Ϭ͘ϭϮϱϰϭϯ Ϭ͘ϬϮϵϰϳϳ Ϭ͘ϭϲϰϮϭϳ ϭ͘ϲϱϴϵϬϲ Ϭ͘ϬϯϬϭϳ Ϭ͘ϱϮϴϱϬϯ Ϭ͘ϭϯϳϯϭϭ Ϭ͘ϬϮϵϰϳϳ Ϭ͘ϭϲϰϮϭϳ ϭ͘ϲϱϴϵϬϲ Ϭ͘Ϭϰϰϵϳϱ Ϭ͘ϴϰϯϱϭϰ ϯ͘ϳϲϳϴϲϮ ϯ͘ϯϳϲϵϴϮ Ϭ͘ϬϬϴϬϮϳ Ϭ͘ϬϬϭϭϯϭ Ϭ͘ϬϬϬϮϲ^ĂŶDĂƚĞŽ ϮϬϮϲ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϱϳϳϰ͘ϱϲϭ ϮϬϳϰϱϯ͘ϯ ϮϬϳϰϱϯ͘ϯ Ϭ ϳϮϲϯϲ͘ϳϭ Ϭ͘ϳϱϵϴϮϲ ϭ͘ϰϮϱϴϰϲ Ϭ Ϭ͘ϬϮϬϴϯϰ Ϭ͘ϬϮϲϱϵϯ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϮϳϯ Ϭ͘ϬϮϭϳϳϲ Ϭ͘ϬϮϳϳϵϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϳϴ ϲϭϴ͘ϬϰϮϳ ϭϮϯ͘ϰϲϰϵ Ϭ Ϭ͘ϬϬϱϯϳϴ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϬϵϳϯϳϯϬ͘ϬϭϵϰϱϮ Ϭ Ϭ͘ϭϭϱϳϵ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϯϭϴϭϵ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϵϵϵϳϭ Ϭ͘Ϯϳϴϴϯϵ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϱϴϱϲ Ϭ͘ϬϬϭϭϳ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯϬϮ͘ϵϲϳϳ ϭϱϲϵϭ͘ϲϲϬ ϭϱϲϵϭ͘ϲϲ ϰϮϯϵ͘ϴϴϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘Ϭϭϯϲϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϯϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϯϵϬ͘Ϯϭϵ ϰϱϯϮϮ͘Ϯϯ ϰϱϯϮϮ͘Ϯϯ Ϭ ϮϬϳϭϮ͘Ϯ Ϭ͘Ϭϴϵϵϰϵ Ϭ͘ϬϯϬϭϯϰ Ϭ͘ϱϮϭϬϭϯ Ϭ͘ϬϬϭϮϱϭ Ϭ Ϭ͘ϬϬϬϭϲϴ Ϭ͘ϬϬϮ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϬϭϯϲϭ Ϭ Ϭ͘ϬϬϬϭϴϯ Ϭ͘ϬϬϴ Ϭ͘Ϭϵϭ ϵϭϲ͘Ϯϳϳϯ ϭϯϮ͘ϰϭϮϭ Ϯϰ͘ϴϮϱϮϯ Ϭ͘ϬϬϯϰϳ Ϭ͘Ϭϵϱϵϵϰ Ϭ͘ϬϮϱϮϰϴ Ϭ͘ϬϬϱϲϰϭ Ϭ͘ϬϬϮϱϳϲ Ϭ͘ϬϰϯϬϴϲ Ϭ͘Ϭϭϱϯϲϰ Ϭ͘ϯϰϱϳϭϯ Ϭ͘ϭϮϭϳϬϲ Ϭ͘ϬϯϬϯϬϰ Ϭ͘ϭϲϲϵϮϮ ϭ͘ϳϯϰϴϵϯ Ϭ͘ϬϮϮϰϮ Ϭ͘ϱϬϰϰϲϯ Ϭ͘ϭϯϯϮϱϯ Ϭ͘ϬϯϬϯϬϰ Ϭ͘ϭϲϲϵϮϮ ϭ͘ϳϯϰϴϵϯ Ϭ͘Ϭϰϰϵϵϳ Ϭ͘ϳϮϭϴϵϱ ϯ͘ϳϳϭϭϴϲ ϯ͘ϯϭϳϵϬϵ Ϭ͘ϬϬϵϬϱϴ Ϭ͘ϬϬϭϯϬϵ Ϭ͘ϬϬϬϮϰϱ^ĂŶDĂƚĞŽ ϮϬϮϲ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϱϴϵ͘ϳϵϵ ϵϮϭϯϵ͘ϯϵ ϵϮϭϯϵ͘ϯϵ Ϭ ϯϮϱϳϲ͘ϰϮ Ϭ͘ϱϵϰϮϵϮ ϭ͘ϯϲϳϵϮϵ Ϭ Ϭ͘Ϭϭϵϴϲϭ Ϭ͘ϬϮϲϳϳϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϮϬϳϱϵ Ϭ͘ϬϮϳϵϴϳ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϵϭ ϳϮϲ͘ϳϭϭ ϭϵϳ͘Ϭϱϴϯ Ϭ Ϭ͘ϬϬϱϮϵ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϭϰϰϵϰ Ϭ͘ϬϯϭϬϰϳ Ϭ Ϭ͘ϭϭϯϴϴϰ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϮϵϲϰϵ Ϭ͘ϭϮϰϵϱϰϬϬϬϬϬ͘ϮϬϲϯϱϵ Ϭ͘Ϯϱϯϳϲϱ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϲϴϴϲ Ϭ͘ϬϬϭϴϲϳ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϳϳ͘Ϯϯϳϴϰ ϯϴϭϬ͘ϱϱ ϬϯϴϭϬ͘ϱϱ ϭϬϮϰ͘ϱϵ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϭϱϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϰϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ Dz ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϰϲϵϮ͘ϴϲ ϴϬϰϯϴ͘ϵϲ ϴϬϰϯϴ͘ϵϲ Ϭ Ϯϵϯϴϱ͘ϳϭ Ϭ͘ϰϵϱϭϮϯ Ϭ Ϭ͘ϭϭϬϬϯϯ Ϭ͘ϬϬϭϵϬϴ Ϭ Ϭ͘ϬϬϯϰϳϵ Ϭ͘ϬϬϭ Ϭ͘ϬϬϰϮ Ϭ͘ϬϬϮϬϰϯ Ϭ Ϭ͘ϬϬϯϳϭϭ Ϭ͘ϬϬϰ Ϭ͘ϬϭϮ ϭϴϲ͘Ϭϱϳϰ Ϭ ϰϯ͘ϯϲϴϳϳ Ϭ͘ϭϯϳϰϰϳ Ϭ Ϭ͘ϭϲϬϲϲϮ Ϭ͘ϬϯϲϬϬϲϬ Ϭ͘ϬϬϲϳϭϵ Ϭ͘ϴϲϭϴϱ Ϭ ϭ͘ϭϲϵϳϮϳ ϯ͘ϱϰϱϲϮϵ ϯ͘ϲϵϳϱϰϰ ϯ͘Ϭϲϳϰϭϱ ϭ͘ϬϱϮϭϴϵ Ϭ ϭ͘ϮϳϮϮϯϵ ϯ͘ϱϰϱϲϮϵ ϯ͘ϲϵϳϱϰϰ ϯ͘Ϭϲϳϰϭϱ Ϭ͘ϬϬϴϵϴϰ ϭϬ͘ϯϳϯϴϭ Ϭ ϳ͘ϲϰϵϵϰϲ Ϭ͘ϬϬϭϴϯϵ Ϭ Ϭ͘ϬϬϬϰϮϵ^ĂŶDĂƚĞŽ ϮϬϮϲ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϵϱϰϭϱ͘Ϭϰ ϮϵϵϱϰϲϮ ϮϵϵϱϰϲϮ Ϭ ϰϱϲϬϮϭ͘ϵ Ϭ͘ϬϰϱϬϰϯ Ϭ Ϭ͘ϮϴϬϮϵϯ Ϭ͘ϬϬϭϬϰϵ Ϭ Ϭ͘ϬϬϭϳϴϳ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϱϮ Ϭ͘ϬϬϭϭϰϭ Ϭ Ϭ͘ϬϬϭϵϰϯ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϲϮ ϯϳϱ͘Ϭϰϳϲ Ϭ ϵϱ͘Ϯϳϰϰϳ Ϭ͘ϬϬϮϬϭϰ Ϭ Ϭ͘Ϭϲϵϰϭϳ Ϭ͘ϬϬϰϰϯϵ Ϭ Ϭ͘ϬϯϮϱϭϲ Ϭ͘ϬϬϳϳϯϯ Ϭ Ϭ͘ϯϮϲϲϴϮ Ϭ͘Ϭϱϴϲϳϳ Ϭ͘ϭϱϵϲϱϱ Ϭ͘ϵϴϴϵϲϲ Ϭ͘ϬϭϭϮϴϰ Ϭ Ϭ͘ϯϱϳϲϳϱ Ϭ͘Ϭϱϴϲϳϳ Ϭ͘ϭϱϵϲϱϱ Ϭ͘ϵϴϴϵϲϲ Ϭ͘ϬϯϵϳϯϮ Ϭ͘ϲϬϴϵϳϵ Ϭ ϯ͘Ϭϰϯϴϭϲ Ϭ͘ϬϬϯϳϬϴ Ϭ Ϭ͘ϬϬϬϵϰϮ^ĂŶDĂƚĞŽ ϮϬϮϲ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϮϲϰ͘ϯϲϰ ϯϴϭϲϯ͘Ϭϵ ϯϴϭϲϯ͘Ϭϵ Ϭ ϱϵϵϯ͘ϳϮϮ Ϭ͘ϬϮϵϲϯϵ Ϭ Ϭ Ϭ͘ϬϬϯϯϲ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϭϱ Ϭ͘ϬϬϯϱϭϮ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϰϰ ϯϴϭ͘ϴϯϱϮ Ϭ Ϭ Ϭ͘ϬϬϬϯϳϭ Ϭ Ϭ Ϭ͘ϬϲϬϭϱϴ Ϭ Ϭ Ϭ͘ϬϬϳϵϳϴϬϬϬϬϬϬ͘ϬϬϵϬϴϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϲϮϴϭϵ Ϭ Ϭ Ϭ͘ϬϬϯϲϭϴ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϮϮϴϴ͘ϭϳϲ ϲϮϴϰϯ͘ϵϯ Ϭ ϲϮϴϰϯ͘ϵϯ ϭϭϱϴϱ͘ϲϳϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϴ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϲϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϭϯϱϮ͘Ϯϴϴ ϰϴϱϭϰ͘ϰϴ ϮϭϲϬϬ͘ϯ Ϯϲϵϭϰ͘ϭϴ ϱϱϵϭ͘ϳϭϭ Ϭ͘ϬϬϮϴϲ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϮϰϬ Ϭ͘ϬϬϭϲϭϯ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϯ Ϭ͘ϬϬϬϰϲϭ Ϭ Ϭ͘ϬϬϭϳϱϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϯϲ ϭϮϬ͘ϭϲϰϲ Ϭ ϴϴ͘ϴϱϰϬϰ Ϭ͘ϬϬϬϯϲϯ Ϭ Ϭ͘ϬϰϭϱϰϮ Ϭ͘ϬϬϬϰϳϲ Ϭ Ϭ͘Ϭϭϵϰϵϯ Ϭ͘ϬϬϭϮϬϮ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϳϱϮϰ Ϭ͘ϬϮϰϯϵ Ϭ͘ϯϬϮϰϮϰ Ϭ͘ϬϬϭϳϱϰ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϳϱϮϰ Ϭ͘ϬϮϰϯϵ Ϭ͘ϯϬϮϰϮϰ Ϭ͘ϬϭϴϳϬ͘ϭϳϵϱϬϳ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϴϴ Ϭ Ϭ͘ϬϬϬϴϳϴ^ĂŶDĂƚĞŽ ϮϬϮϲ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϲϬ͘ϭϲϮϵ ϴϮϴϴ͘ϲϴϱ ϴϮϴϴ͘ϲϴϱ Ϭ ϴϲ͘ϬϱϬϳ Ϭ͘ϮϯϮϱϲ Ϭ Ϭ͘ϯϵϳϯϴϰ Ϭ͘ϬϬϭϱϭϮ Ϭ Ϭ͘ϬϬϬϯϴϰ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϲϰϱ Ϭ Ϭ͘ϬϬϬϰϭϴ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϵϰϱ͘ϴϮϲ Ϭ ϯϭ͘ϭϬϱϳϴ Ϭ͘ϬϬϴϲϲϴ Ϭ Ϭ͘ϬϯϱϮϯϵ Ϭ͘Ϭϭϳϲϰϰ Ϭ Ϭ͘ϬϰϰϮϱϰ Ϭ͘Ϭϯϯϵϰϵ Ϭ Ϭ͘ϭϰϭϲϰ ϳ͘ϯϴϳϮϬϲ Ϭ͘ϭϳϳϯϮϯ Ϯ͘ϳϬϰϲϮϰ Ϭ͘Ϭϰϵϱϯϴ Ϭ Ϭ͘ϭϱϱϬϳϵ ϳ͘ϯϴϳϮϬϲ Ϭ͘ϭϳϳϯϮϯ Ϯ͘ϳϬϰϲϮϰ Ϭ͘Ϭϰϰϵϲϳ Ϭ͘ϳϮϬϰϳϳ Ϭ ϯ͘ϭϵϬϵϭϴ Ϭ͘ϬϭϵϮϯϲ ϬϬ͘ϬϬϬϯϬϴ^ĂŶDĂƚĞŽ ϮϬϮϲ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϭϭ͘ϳϲϴϲ ϰϬϭϲ͘ϯϱϯ ϰϬϭϲ͘ϯϱϯϬ ϰϭ͘ϭϳϲϴϲ Ϯ͘ϵϬϮϯϮϮ Ϭ Ϭ Ϭ͘ϬϰϬϳϬϭ Ϭ Ϭ Ϭ͘ϬϬϰ Ϭ͘Ϭϭϱϲϳϱ Ϭ͘ϬϰϮϱϰϮ Ϭ Ϭ Ϭ͘Ϭϭϲ Ϭ͘Ϭϰϰϳϴϱ ϭϬϴϲ͘ϰϰϯ Ϭ Ϭ Ϭ͘ϬϬϰϬϬϲ Ϭ Ϭ Ϭ͘ϭϳϭϭϳ Ϭ Ϭ Ϭ͘ϬϴϲϮϱϳϬϬϬϬϬϬ͘Ϭϵϴϭϵϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϵϴϬϬϰ Ϭ͘Ϯϲϰϵϴϰ Ϭ Ϭ Ϭ͘ϬϭϬϮϵϱ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϰϴ͘ϱϱϳϯ ϰϴϭϲϵ͘ϰϯ ϰϴϭϲϵ͘ϰϯ Ϭ ϭϲϵϳϳ͘ϵϰ Ϭ͘ϮϲϵϰϭϮ Ϭ͘Ϭϴϭϵϵϲ Ϭ͘ϰϬϭϯϵϵ Ϭ͘ϬϬϭϯϰϵ Ϭ Ϭ͘ϬϬϬϰϵϱ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϰϲϳ Ϭ Ϭ͘ϬϬϬϱϯϵ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϲϵϳ͘ϭϭϴ ϱϭϮ͘ϳϲϯϳ ϰϯ͘ϰϱϯϲϱ Ϭ͘ϬϬϴϳϳϵ Ϭ͘Ϯϲϵϰϱϱ Ϭ͘Ϭϰϯϰϲϱ Ϭ͘ϬϭϱϮϳϲ Ϭ͘ϬϬϳϮϰϲ Ϭ͘ϬϯϯϮϮϵ Ϭ͘ϬϰϭϱϮϳ ϭ͘Ϭϭϵϱϳϴ Ϭ͘ϮϮϵϴϯϰ Ϭ͘ϬϮϰϮϮϮ Ϭ͘ϮϬϬϬϬϴ ϭ͘ϵϭϭϴϰϴ Ϭ͘ϬϲϬϱϵϲ ϭ͘ϰϴϳϳϲϲ Ϭ͘Ϯϱϭϲϯϵ Ϭ͘ϬϮϰϮϮϮ Ϭ͘ϮϬϬϬϬϴ ϭ͘ϵϭϭϴϰϴ Ϭ͘Ϭϰϰϵϵϳ Ϭ͘ϴϯϬϭϯϴ ϭϱ͘ϭϵϲϭϴ ϱ͘ϬϬϱϬϳϳ Ϭ͘Ϭϭϲϳϳϴ Ϭ͘ϬϬϱϬϲϵ Ϭ͘ϬϬϬϰϯ^ĂŶDĂƚĞŽ ϮϬϮϲ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϯϰϱ͘Ϭϯ ϭϳϳϴϬϵ͘ϯ ϭϳϳϴϬϵ͘ϯ Ϭ ϱϮϰϵϬ͘ϯϳ ϭ͘Ϭϳϵϱϰϯ ϭϮ͘ϭϵϴϮ ϭ͘ϲϭϱϮϮϴ Ϭ͘ϬϭϭϵϴϮ Ϭ͘ϬϮϮϳϮϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϵϴϮϬ͘ϬϭϮϱϮϰ Ϭ͘ϬϮϯϳϰϵ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϲϲϰ ϭϭϯϴ͘ϱϱϲ ϮϮϬϵ͘ϭϲ Ϭ Ϭ͘ϬϬϭϮϵϰ Ϭ͘ϬϭϬϲϳϱ ϬϬ͘ϭϳϵϯϴ Ϭ͘ϯϰϴϬϱϰ Ϭ Ϭ͘ϬϮϳϴϱϯ Ϭ͘ϮϮϵϴϯϮϬϬϬϬϬ͘ϬϯϭϳϬϵ Ϭ͘ϮϲϭϲϰϲϬϬϬϬϬ͘ϮϭϭϴϮϲ Ϭ͘ϭϬϴϳϳϭ ϳ͘ϱϬϱϮϵϯ Ϭ Ϭ͘ϬϭϬϳϴϭ Ϭ͘ϬϮϬϵϭϵ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϳϲ͘Ϭϭϭϵϰ ϰϮϳϲ͘ϱϭϮ ϬϰϮϳϲ͘ϱϭϮ ϭϬϱϴ͘ϱϰϰϬϬϬϬϬϬϬ͘ϬϬϯϬ͘ϬϬϳϵϱϭ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϳϭϳϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϰϴ͘Ϭϱϲϱϴ Ϯϭϳϵ͘ϴϰϯ Ϯϭϳϵ͘ϴϰϯ Ϭ ϰϰϮ͘Ϯϱϰ Ϭ͘ϭϭϮϵϳϳ ϲ͘ϰϴϬϮϴϰ Ϭ Ϭ͘ϬϬϭϯϮϳ Ϭ͘Ϭϭϵϲϲϯ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϲϬϵϭ Ϭ͘ϬϬϭϰϰϯ Ϭ͘ϬϮϭϯϴϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϵϳϰ ϵϵϭ͘ϰϴϳϭ ϱϰϬϳ͘ϭϳϴ Ϭ Ϭ͘ϳϳϴϳϴϲ ϭϲ͘ϲϴϱϴϯ Ϭ Ϭ͘ϮϬϮϭϮϭ ϭ͘ϭϬϮϮϴϵ Ϭ Ϭ͘ϬϭϭϭϮϳ Ϭ͘ϮϯϴϰϬϴ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϳϵϰϴϬϴ ϭϳ͘ϬϮϵϭϭ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘Ϭϲϯϳϭϴ ϯϴ͘ϭϱϱϱϴ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϮϱϬ͘ϮϭϮϮ ϭϯϬϳϴ͘ϯϲ ϭϯϬϳϴ͘ϯϲ Ϭ ϱϬϬϲ͘Ϯϰϱ Ϭ͘ϮϮϴϱϳϴ Ϭ͘Ϭϲϭϴϭϳ Ϭ͘ϯϱϵϳϰϳ Ϭ͘ϬϬϭϬϲϳ Ϭ Ϭ͘ϬϬϬϮϴϱ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϲϴ Ϭ͘ϬϬϭϭϲ Ϭ Ϭ͘ϬϬϬϯϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϳϵϵ ϭϲϴϳ͘ϰϰϲ ϯϲϱ͘ϯϭϬϵ Ϯϵ͘ϰϮϮϮϵ Ϭ͘ϬϬϲϵϮϳϬ͘ϮϬϰϲϱ Ϭ͘ϬϯϮϬϯ Ϭ͘Ϭϭϯϴϲϳ Ϭ͘ϬϬϱϱϵϭ Ϭ͘ϬϯϬϵϱϱ Ϭ͘Ϭϯϭϱϳϰ Ϭ͘ϳϰϳϳϬϵ Ϭ͘ϭϱϵϬϯϮ Ϭ͘ϬϮϱϳϭϲ Ϭ͘ϭϮϮϯϱϯ Ϯ͘ϬϵϬϱϰϯ Ϭ͘ϬϰϲϬϳϯ ϭ͘ϬϵϭϬϱϲ Ϭ͘ϭϳϰϭϮ Ϭ͘ϬϮϱϳϭϲ Ϭ͘ϭϮϮϯϱϯ Ϯ͘ϬϵϬϱϰϯ Ϭ͘Ϭϰϰϵϳϰ Ϭ͘ϲϲϮϳϬϯ ϱ͘ϳϴϯϮϳϮ ϯ͘Ϯϴϰϲϳϲ Ϭ͘ϬϭϲϲϴϮ Ϭ͘ϬϬϯϲϭϭ Ϭ͘ϬϬϬϮϵϭ^ĂŶDĂƚĞŽ ϮϬϮϲ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϭϰϱ͘ϰϵϮ ϳϱϲϭϭ͘ϰϳ ϳϱϲϭϭ͘ϰϳ Ϭ ϭϭϮϯϯ͘ϭϳ Ϭ͘ϳϵϮϮ ϱ͘ϰϭϮϭϲϱ ϭ͘ϰϴϮϰϵϴ Ϭ͘ϬϬϵϬϲ Ϭ͘ϬϬϯϬϴϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϳϰϬϯ Ϭ͘ϬϬϵϰϳ Ϭ͘ϬϬϯϮϮϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϰϵϳϮϰ ϭϮϭϰ͘ϰϯϭ ϭϮϬϮ͘ϰϯϵ Ϭ Ϭ͘ϬϬϬϴϵϲ Ϭ͘ϬϭϰϮϳϳ Ϭ Ϭ͘ϭϵϭϯϯϰ Ϭ͘ϭϴϵϰϰϱ Ϭ Ϭ͘ϬϭϵϮϴϯ Ϭ͘ϯϬϳϯϳϭϬϬϬϬϬ͘ϬϮϭϵϱϯ Ϭ͘ϯϰϵϵϭϵ Ϭ Ϭ Ϭ Ϭ Ϭ͘Ϯϭϳϵϰ Ϭ͘Ϭϵϭϯϲ ϱ͘ϳϯϯϯϯϱ Ϭ Ϭ͘Ϭϭϭϱ Ϭ͘Ϭϭϭϯϴϲ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯ͘ϱϵϯϴϭ Ϯϵϳ͘ϯϴϵϴ Ϭ Ϯϵϳ͘ϯϴϵϴ ϳϭ͘ϵϬϰϵϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϬϳϴϰ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϯϵϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϬ͘ϰϭϮϭϭ ϲϲϵ͘ϰϱϰ ϲϲϵ͘ϰϱϰ Ϭ ϵϮ͘ϲϲϳϳϲ Ϭ͘ϭϰϰϴϲ ϭ͘ϱϮϬϯϳϱ Ϭ Ϭ͘ϬϬϭϮϳϳ Ϭ͘ϬϬϰϯϬϲ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϲϭϰϴ Ϭ͘ϬϬϭϯϴϵ Ϭ͘ϬϬϰϲϴϯ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϲϭϯϳ ϵϳϳ͘Ϯϵϭϵ ϭϭϵϮ͘ϯϯ Ϭ Ϭ͘ϴϭϰϲϲϱ ϰ͘ϬϮϲϱϭϳ Ϭ Ϭ͘ϭϵϵϮϮϳ Ϭ͘ϮϰϯϬϲϰ Ϭ Ϭ͘Ϭϭϭϲϰ Ϭ͘ϬϱϳϱϯϭϬϬϬϬϬ͘ϴϯϭϰϮϲϰ͘ϭϬϵϯϱϲ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘ϯϮϭϯϮϳ ϴ͘ϮϲϵϰϯϲϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϱ͘ϲϲϵϳϳ ϯϳϵϮ͘Ϯϴϯ ϯϳϵϮ͘Ϯϴϯ Ϭ ϯϬϮ͘ϲϳϵϭ Ϭ͘ϲϴϵϰϬϴ Ϭ͘ϴϱϬϬϳϲ Ϭ͘ϲϭϰϬϬϴ Ϭ͘ϬϬϭϭϬϰ Ϭ Ϭ͘ϬϬϬϳϮϯ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϭϮϬϭ Ϭ Ϭ͘ϬϬϬϳϴϳ Ϭ͘ϬϬϴ Ϭ͘Ϭϰϰϵϭϳ ϳϳϱ͘ϳϳϵϴ Ϯϰϴϭ͘ϴϱϰ ϱϴ͘ϲϳϰϴϯ Ϭ͘Ϭϭϱϵϭϳ Ϯ͘ϰϰϳϮϰϳ Ϭ͘ϬϴϮϬϲϳ Ϭ͘ϬϯϯϮϯϴ Ϭ͘ϬϴϬϮϲϳ Ϭ͘ϬϱϲϬϮϭ Ϭ͘Ϭϳϳϵϳϯ ϭϬ͘ϲϮϮϵϳ Ϭ͘ϰϳϰϲϮϴ Ϭ͘ϭϭϴϴϭϯ Ϭ͘ϯϲϵϵϵϱ ϭ͘ϵϳϱϲϱϴ Ϭ͘ϭϭϯϳϳϴ ϭϱ͘ϱϬϭϬϮ Ϭ͘ϱϭϵϲϱϴ Ϭ͘ϭϭϴϴϭϯ Ϭ͘ϯϲϵϵϵϱ ϭ͘ϵϳϱϲϱϴ Ϭ͘Ϭϰϱ ϭ͘ϵϴϵϱϳ ϴϮ͘ϭϮϴϮϲ ϭϭ͘ϳϮϵϳϵ Ϭ͘ϬϬϳϲϲϵ Ϭ͘ϬϮϰϱϯϲ Ϭ͘ϬϬϬϱϴ^ĂŶDĂƚĞŽ ϮϬϮϲ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϲϴ͘ϰϳϲϰ ϯϳϯϳ͘Ϭϱϰ ϯϳϯϳ͘Ϭϱϰ Ϭ Ϯϰϯϵ͘ϱϯϴ ϰ͘ϬϵϮϬϵϳ Ϯϭ͘ϱϮϵϴ Ϭ͘ϰϵϰϴϱϭ Ϭ͘Ϭϭϵϲϯϭ Ϭ͘Ϭϭϵϳϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭϬ͘ϬϮϬϱϭϵ Ϭ͘ϬϮϬϲϲϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϭϯϯ͘ϳϯ ϮϮϭϰ͘Ϯϲϭ Ϭ Ϭ͘ϬϬϮϴϲϮ Ϭ͘ϬϬϴϬϱϭ ϬϬ͘ϭϳϴϲϮ Ϭ͘ϯϰϴϴϱϴ Ϭ Ϭ͘ϬϲϭϲϮ Ϭ͘ϭϳϯϯϯϭϬϬϬϬϬ͘ϬϳϬϭϱ Ϭ͘ϭϵϳϯϮϱ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϰϵϯϯϱ Ϭ͘ϭϴϵϯϴϲ ϰ͘ϲϴϱϮϵϭ Ϭ Ϭ͘ϬϭϬϳϯϲ Ϭ͘ϬϮϬϵϲϴ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯ͘Ϯϴϭϯϵϳ ϭϮϳ͘ϳϬϱϳ ϬϭϮϳ͘ϳϬϱϳ Ϯϵ͘ϱϬϵϲϰ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮϯϮϲ Ϭ͘ϬϬϳϴϲ Ϭ Ϭ Ϭ Ϭ͘ϬϬϵϯϬϯ Ϭ͘ϬϮϮϰϱϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲ͘ϴϬϳϳϳϳ ϭϲϴ͘Ϯϲϳϲ ϭϲϴ͘Ϯϲϳϲ Ϭ ϵϴ͘ϱϳϲϲ Ϭ͘ϰϵϳϴϵ ϱ͘ϮϮϵϭϭ Ϭ Ϭ͘ϬϬϯϯϳϴ Ϭ͘ϬϭϮϯϱϰ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϯϲϳϰ Ϭ͘Ϭϭϯϰϯϲ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϮϮϴ͘ϰϳϰ ϰϭϬϮ͘ϵϱϰ Ϭ ϯ͘Ϯϰϳϯϯϴ ϭϰ͘ϳϰϬϳϰ Ϭ Ϭ͘ϮϱϬϰϯϮ Ϭ͘ϴϯϲϰϭϰ Ϭ Ϭ͘Ϭϰϲϯϵϴ Ϭ͘ϮϭϬϲϭϲϬϬϬϬϯ͘ϯϭϰϭϰϳ ϭϱ͘ϬϰϰϬϬϬϬϭ͘ϬϲϭϬ͘ϳϱϴϬϮ ϮϮ͘ϵϵϰϭϳ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϭ͘ϴϬϲϵϲ ϰϮϬϮ͘ϲϳϴ ϰϮϬϮ͘ϲϳϴ Ϭ Ϯϰϳ͘ϮϮϳϴ Ϭ͘Ϭϯϯϴϯϳ Ϭ Ϭ͘ϯϴϮϯϵ Ϭ͘ϬϬϭϭϴϲ Ϭ Ϭ͘ϬϬϬϭϲϯ Ϭ͘ϬϬϮϬϳϯ Ϭ͘ϬϯϮϯϯϯ Ϭ͘ϬϬϭϮϵ Ϭ Ϭ͘ϬϬϬϭϳϳ Ϭ͘ϬϬϴϮϵ Ϭ͘ϬϵϮϯϳϵ ϵϱϰ͘ϱϭϱϲ Ϭ ϯϵ͘ϬϬϲϱ Ϭ͘ϬϬϭϳϵϲ Ϭ Ϭ͘ϬϯϲϭϭϯϬ͘ϬϬϰϱϮϳ Ϭ Ϭ͘ϬϱϳϱϱϮ Ϭ͘ϬϬϱϬϱϴ Ϭ Ϭ͘ϭϯϬϴϯϰ Ϭ͘ϬϮϵϰϳϯ Ϭ͘ϬϵϬϴϲϳ Ϭ͘ϯϰϱϵϲϮ Ϭ͘ϬϬϳϯϴϭ Ϭ Ϭ͘ϭϰϯϮϰϲ Ϭ͘ϬϮϵϰϳϯ Ϭ͘ϬϵϬϴϲϳ Ϭ͘ϯϰϱϵϲϮ Ϭ͘Ϭϰϱ Ϭ͘ϱϱϴϴϮϯ Ϭ ϲ͘ϱϰϵϮϴϲ Ϭ͘ϬϬϵϰϯϲ Ϭ Ϭ͘ϬϬϬϯϴϲ^ĂŶDĂƚĞŽ ϮϬϮϲ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϳϴ͘ϴϰϳϴ Ϯϭϱϳϱ͘ϴϳ Ϯϭϱϳϱ͘ϴϳ Ϭ ϭϭϭϱ͘ϯϵϭ Ϭ͘ϯϳϱϱϰ Ϭ Ϭ Ϭ͘ϬϬϲϴϮϳ Ϭ Ϭ Ϭ͘ϬϬϴϬϵϳ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϳϭϯϱ Ϭ Ϭ Ϭ͘ϬϯϮϯϴϲ Ϭ͘ϭϭ ϭϮϮϯ͘ϰϴϳ Ϭ Ϭ Ϭ͘ϬϬϯϭϰϱ Ϭ Ϭ Ϭ͘ϭϵϮϳϲϭ Ϭ Ϭ Ϭ͘ϬϲϳϳϭϱϬϬϬϬϬϬ͘ϬϳϳϬϴϵ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϮ Ϭ͘Ϭϳϳϭϵ Ϭ Ϭ Ϭ͘Ϭϭϭϱϵϯ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϲ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯϳ͘ϱϱϱϱϲ ϯϴϴϵ͘ϳϳϰ Ϭϯϴϴϵ͘ϳϳϰ ϭϱϬ͘ϮϮϮϮϬϬϬϬϬϬϬ͘ϬϬϳϯϳϭ Ϭ͘ϬϭϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϮϵϰϴϯ Ϭ͘ϬϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϲ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲϱ͘ϳϲϵϲϲ ϰϱϱϰ͘Ϯϭ ϰϱϱϰ͘Ϯϭ Ϭ Ϯϲϯ͘Ϭϳϴϳ Ϭ͘Ϭϱϱϰϰϭ Ϭ Ϭ Ϭ͘ϬϬϬϮϳϮ Ϭ Ϭ Ϭ͘ϬϬϳϳϰϯ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϬϮϴϱ Ϭ Ϭ Ϭ͘ϬϯϬϵϳϮ Ϭ͘ϭϭ ϭϮϲϮ͘ϴϯϳ Ϭ Ϭ ϰ͘ϭϬϭϮϰϵ Ϭ Ϭ Ϭ͘Ϯϱϳϰϯϴ Ϭ Ϭ Ϭ͘ϬϱϴϱϵϵϬϬϬϬϬϰ͘ϭϴϱϲϮϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϵϳ ϰϲ͘ϱϭϴϴϳ Ϭ Ϭ Ϭ Ϭ Ϭ ^ŽƵƌĐĞ͗D&ϮϬϮϭ;ǀϭ͘Ϭ͘ϮͿŵŝƐƐŝŽŶZĂƚĞƐZĞŐŝŽŶdǇƉĞ͗ŽƵŶƚǇZĞŐŝŽŶ͗^ĂŶDĂƚĞŽĂůĞŶĚĂƌzĞĂƌ͗ϮϬϮϳ^ĞĂƐŽŶ͗ŶŶƵĂůsĞŚŝĐůĞůĂƐƐŝĨŝĐĂƚŝŽŶ͗D&ϮϬϬϳĂƚĞŐŽƌŝĞƐhŶŝƚƐ͗ŵŝůĞƐͬĚĂǇĨŽƌsDdĂŶĚsDd͕ƚƌŝƉƐͬĚĂǇĨŽƌdƌŝƉƐ͕ŐͬŵŝůĞĨŽƌZhEy͕WDtĂŶĚWDdt͕ŐͬƚƌŝƉĨŽƌ^dZy͕,Kd^K<ĂŶĚZhE>K^^͕ŐͬǀĞŚŝĐůĞͬĚĂǇĨŽƌ/>yĂŶĚ/hZE͘W,sĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŽƚĂůsDd͘ZĞŐŝŽŶ ĂůĞŶĚĂƌz sĞŚŝĐůĞĂƚDŽĚĞůzĞĂ ^ƉĞĞĚ &ƵĞů WŽƉƵůĂƚŝŽŶdŽƚĂůsDd sDd sDd dƌŝƉƐ EKǆͺZhEEKǆͺ/>yEKǆͺ^dZyWDϮ͘ϱͺZh WDϮ͘ϱͺ/>WDϮ͘ϱͺ^dZWDϮ͘ϱͺWDWDϮ͘ϱͺWDWDϭϬͺZhEWDϭϬͺ/>WDϭϬͺ^dZ WDϭϬͺWDdWDϭϬͺWDKϮͺZhEKϮͺ/>yKϮͺ^dZy,ϰͺZhE,ϰͺ/>y,ϰͺ^dZyEϮKͺZhEEϮKͺ/>yEϮKͺ^dZyZK'ͺZhEZK'ͺ/>yZK'ͺ^dZyZK'ͺ,Kd^ZK'ͺZhE>ZK'ͺ/hZdK'ͺZhEdK'ͺ/>ydK'ͺ^dZydK'ͺ,Kd^dK'ͺZhE>dK'ͺ/hZ E,ϯͺZhEKͺZhEyKͺ/>y Kͺ^dZy ^KǆͺZhE ^Kǆͺ/>y ^Kǆͺ^dZy^ĂŶDĂƚĞŽ ϮϬϮϳ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϰ͘ϮϮϮϬϭ ϰϲϱ͘ϵϳϯϱ ϰϲϱ͘ϵϳϯϱ Ϭ ϴϰ͘ϰϳϯϵϴ ϯ͘ϳϴϰϰϬϭ Ϭ Ϭ͘ϬϬϭϴϬϵ Ϭ͘ϬϬϭϯϳ Ϭ Ϭ͘ϬϬϬϲϭϮ Ϭ͘ϬϬϱ Ϭ͘ϬϯϭϭϬϭ Ϭ͘ϬϬϭϰϵ Ϭ Ϭ͘ϬϬϬϲϲϲ Ϭ͘ϬϮ Ϭ͘Ϭϴϴϴϱϵ Ϯϭϴϳ͘ϵϭϱ Ϭ ϱϬ͘ϳϳϰϬϭ Ϭ͘ϭϬϴϰϴ Ϭ ϵ͘ϯϴͲϬϱ Ϭ͘ϭϰϳϴϭϱ Ϭ ϵ͘ϰͲϬϱ Ϭ͘ϱϮϵϯϱϳ Ϭ Ϭ͘ϬϬϬϱϬϴ Ϭ͘ϬϮϵϵϵ Ϭ͘ϮϮϮϲϯϵ Ϯ͘ϬϱϰϱϴϮ Ϭ͘ϳϳϮϰϯϳ Ϭ Ϭ͘ϬϬϬϱϱϲ Ϭ͘ϬϮϵϵϵ Ϭ͘ϮϮϮϲϯϵ Ϯ͘ϬϱϰϱϴϮ Ϭ͘Ϭϰϱ ϯϯ͘Ϭϵϱϯϳ Ϭ ϰ͘ϳϮϱϯϲϵ Ϭ͘ϬϮϭϲϯ Ϭ Ϭ͘ϬϬϬϱϬϮ^ĂŶDĂƚĞŽ ϮϬϮϳ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϯϰϲ͘ϭϱϭ ϭϭϵϯϳϰ͘ϵ ϭϭϵϯϳϰ͘ϵ Ϭ ϭϱϬϬϯ͘ϱϴ Ϯ͘ϰϬϳϮϬϰ ϰϯ͘ϰϮϵϲϰ ϯ͘Ϭϲϰϴϯϴ Ϭ͘ϬϮϰϭϬϳ Ϭ͘ϬϮϵϮϳϭ Ϭ Ϭ͘ϬϬϴϲϬϳ Ϭ͘ϬϯϬϮϬϵ Ϭ͘ϬϮϱϭϵϳ Ϭ͘ϬϯϬϱϵϱ Ϭ Ϭ͘ϬϯϰϰϮϵ Ϭ͘ϬϴϲϯϭϮ ϭϳϮϭ͘ϭ ϳϵϱϳ͘ϰϰϯ Ϭ Ϭ͘ϬϬϭϭϭϯ Ϭ͘ϭϱϵϳϮϯ Ϭ Ϭ͘Ϯϳϭϭϲ ϭ͘Ϯϱϯϲϵϴ Ϭ Ϭ͘ϬϮϯϵϱϴ ϯ͘ϰϯϴϳϵϯϬϬϬϬϬ͘ϬϮϳϮϳϱ ϯ͘ϵϭϰϴϬϰϬϬϬϬϬ͘ϮϬϯϵϲϭ Ϭ͘ϭϬϯϵϱϭ ϰϴ͘ϳϮϰϲϳ Ϭ Ϭ͘ϬϭϲϮϵϴ Ϭ͘ϬϳϱϯϱϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯϳ͘ϳϮϯϳϵ Ϯϱϯϯ͘Ϭϳϰ ϬϮϱϯϯ͘Ϭϳϰ Ϯϲϵ͘ϳϱϭϲϬϬϬϬϬϬϬ͘ϬϬϴϰϴϲ Ϭ͘Ϭϭϳϰϳϯ Ϭ Ϭ Ϭ Ϭ͘Ϭϯϯϵϰϲ Ϭ͘ϬϰϵϵϮϮϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϵϵ͘ϲϰϯϳ ϭϮϴϳϰ͘ϱϰ ϭϮϴϳϰ͘ϱϰ Ϭ ϭϯϬϬ͘ϴϳϴ ϭ͘Ϭϴϰϯϰϱ ϳ͘ϴϬϯϵϱϮ Ϭ Ϭ͘ϬϬϭϱϱϯ Ϭ͘ϬϭϮϭϵϴ Ϭ Ϭ͘ϬϬϵ Ϭ͘Ϭϲϭϱϰϭ Ϭ͘ϬϬϭϲϴϵ Ϭ͘ϬϭϯϮϲϲ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϭϳϱϴϯϭ ϭϰϯϯ͘ϱϮϲ ϴϭϯϯ͘ϱϲϵ Ϭ Ϯ͘ϯϰϭϴϮϴ ϮϬ͘ϬϬϵϯϵ ϬϬ͘ϮϵϮϮϯϰ ϭ͘ϲϱϴϬϴϭ Ϭ Ϭ͘ϬϰϵϭϮϵ Ϭ͘ϯϭϯϬϱϭϬϬϬϬϮ͘ϰϬϳϴϱϵ ϮϬ͘ϰϱϭϵϵϬϬϬϬϬ͘ϳϬϲϲϳϴ ϭϰ͘ϰϵϴϮϵ ϲϬ͘ϰϬϮϳϰ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϯϴϰϳϭ͘ϯ ϲϳϴϳϳϰϱ ϲϳϴϳϳϰϱ Ϭ ϭϭϭϴϱϵϱ Ϭ͘ϬϮϵϱϱϳ Ϭ Ϭ͘Ϯϭϳϭϵϴ Ϭ͘ϬϬϭϬϭϵ Ϭ Ϭ͘ϬϬϭϳϲϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϰϴ Ϭ͘ϬϬϭϭϬϴ Ϭ Ϭ͘ϬϬϭϵϭϲ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϳϭ Ϯϱϰ͘ϴϭϮϴ Ϭ ϲϰ͘ϯϵϵϭϭ Ϭ͘ϬϬϭϱϰϮ Ϭ Ϭ͘Ϭϱϲϳϴϱ Ϭ͘ϬϬϯϲϱϬ Ϭ͘ϬϮϴϰϭ Ϭ͘ϬϬϱϲϴ Ϭ Ϭ͘ϮϲϬϱϭϳ Ϭ͘Ϭϳϰϯϵ Ϭ͘ϭϵϴϰϵϲ ϭ͘ϭϴϵϱϭ Ϭ͘ϬϬϴϮϴϴ Ϭ Ϭ͘ϮϴϱϮϯϰϬ͘Ϭϳϰϯϵ Ϭ͘ϭϵϴϰϵϲ ϭ͘ϭϴϵϱϭ Ϭ͘ϬϯϴϮϴϭ Ϭ͘ϱϰϳϳϴϰ Ϭ Ϯ͘ϳϭϴϲϳϯ Ϭ͘ϬϬϮϱϭϵ Ϭ Ϭ͘ϬϬϬϲϯϳ^ĂŶDĂƚĞŽ ϮϬϮϳ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϱϳϳ͘ϲϯϬϲ ϭϭϴϱϵ͘ϭϱ ϭϭϴϱϵ͘ϭϱ Ϭ ϮϰϯϬ͘ϵϱϯ Ϭ͘ϭϮϱϬϲϯ Ϭ Ϭ Ϭ͘ϬϬϴϳϮϯ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϰϭϳ Ϭ͘ϬϬϵϭϭϳ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϵϬϱ ϮϮϰ͘Ϯϲ Ϭ Ϭ Ϭ͘ϬϬϬϳϵϰ Ϭ Ϭ Ϭ͘ϬϯϱϯϯϮ Ϭ Ϭ Ϭ͘ϬϭϳϬϵϬϬϬϬϬϬ͘Ϭϭϵϰϱϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘Ϯϲϳϳϲϭ Ϭ Ϭ Ϭ͘ϬϬϮϭϮϱ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯϭϳϱϱ͘ϴϯ ϳϲϯϰϳϴ͘ϴ Ϭ ϳϲϯϰϳϴ͘ϴ ϭϬϲϳϮϮ͘ϱϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϮ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϳϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϴϴϭϯ͘ϵϯϱ ϮϴϱϲϮϯ͘ϯ ϭϯϭϮϵϰ͘ϴ ϭϱϰϯϮϴ͘ϱ ϯϲϰϰϱ͘ϲϮ Ϭ͘ϬϬϮϵϱϯ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϳϯ Ϭ Ϭ͘ϬϬϭϳϯϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϯϴ Ϭ͘ϬϬϬϱϭϰ Ϭ Ϭ͘ϬϬϭϴϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϮϰ ϭϮϰ͘Ϭϱϭϴ Ϭ ϲϭ͘ϲϲϮϲϴ Ϭ͘ϬϬϬϯϳϮ Ϭ Ϭ͘Ϭϰϭϭϳϭ Ϭ͘ϬϬϬϰϴϯ Ϭ Ϭ͘Ϭϭϵϭϰϵ Ϭ͘ϬϬϭϮϰϭ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘Ϭϯϴϱϵ Ϭ͘ϬϯϴϯϮϮ Ϭ͘ϰϭϲϯϳϭ Ϭ͘ϬϬϭϴϭϭ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘Ϭϯϴϱϵ Ϭ͘ϬϯϴϯϮϮ Ϭ͘ϰϭϲϯϳϭ Ϭ͘Ϭϭϴϲϴϯ Ϭ͘ϭϴϱϮϳϱ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϮϲ Ϭ Ϭ͘ϬϬϬϲϭ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϲϰϭϵ͘ϭϴ ϳϭϯϵϵϵ͘ϭ ϳϭϯϵϵϵ͘ϭ Ϭ ϭϮϭϯϯϰ͘ϱ Ϭ͘ϬϲϵϭϬϯ Ϭ Ϭ͘Ϯϳϱϴϭ Ϭ͘ϬϬϭϮϰϭ Ϭ Ϭ͘ϬϬϮϬϮϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϭϴ Ϭ͘ϬϬϭϯϰϵ Ϭ Ϭ͘ϬϬϮϭϵϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϱϭ Ϯϵϴ͘ϭϭϱϭ Ϭ ϳϲ͘ϲϴϰϯϴ Ϭ͘ϬϬϯϮϭϱ Ϭ Ϭ͘Ϭϳϭϯϯϳ Ϭ͘ϬϬϱϳϵϵ Ϭ Ϭ͘Ϭϯϭϰϱϲ Ϭ͘Ϭϭϯϳϲ Ϭ Ϭ͘ϯϰϵϰϳϳ Ϭ͘ϭϬϱϮϯϵ Ϭ͘ϮϵϮϰϬϴ ϭ͘ϲϴϳϭϲϱ Ϭ͘ϬϮϬϬϳϴ ϬϬ͘ϯϴϮϲϯϯ Ϭ͘ϭϬϱϮϯϵ Ϭ͘ϮϵϮϰϬϴ ϭ͘ϲϴϳϭϲϱ Ϭ͘Ϭϯϴϴϲ Ϭ͘ϴϯϴϱϭϴ Ϭ ϯ͘ϱϵϳϳϯϯ Ϭ͘ϬϬϮϵϰϳ Ϭ Ϭ͘ϬϬϬϳϱϴ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭ͘ϯϳϰϮϴϯ ϭϴ͘ϱϮϱϴ ϭϴ͘ϱϮϱϴϬ ϰ͘ϭϯϴϮϬϱ Ϭ͘ϵϴϴϮϵϵ Ϭ Ϭ Ϭ͘ϭϰϳϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϯϭϱϱ Ϭ͘ϭϱϯϳϱϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϬϭϲϯϳϳ͘ϰϯϳϵ Ϭ Ϭ Ϭ͘ϬϭϭϬϵϯ Ϭ Ϭ Ϭ͘Ϭϱϵϰϲϱ Ϭ Ϭ Ϭ͘ϮϯϴϴϮϱϬϬϬϬϬϬ͘Ϯϳϭϴϴϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ ϭ͘ϳϯϱϯϳϴ Ϭ Ϭ Ϭ͘ϬϬϯϱϳϲ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϳϱ͘ϲϯϯϮ ϲϮϵϳ͘ϭϵϲ ϬϲϮϵϳ͘ϭϵϲ ϴϲϱ͘ϲϵϬϵ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϯϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϭϯϰ͘ϳϵϱϳ ϰϳϰϵ͘ϳϰ ϮϬϬϭ͘ϯϰϲ Ϯϳϰϴ͘ϯϵϰ ϱϱϳ͘ϯϴϬϭ Ϭ͘ϬϬϮϳϬϳ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϬϯ Ϭ Ϭ͘ϬϬϭϮϮϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϱϮ Ϭ͘ϬϬϬϯϯ Ϭ Ϭ͘ϬϬϭϯϮϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϲϮ ϭϭϯ͘ϳϮϳϳ Ϭ ϲϲ͘ϬϯϮϱ Ϭ͘ϬϬϬϯϰϭ Ϭ Ϭ͘Ϭϰϭϭϱϵ Ϭ͘ϬϬϬϰϰϮ Ϭ Ϭ͘Ϭϭϵϭϯϳ Ϭ͘ϬϬϭϭϯϴ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϯϬϳϳ Ϭ͘Ϭϭϵϴϰϴ Ϭ͘ϮϲϱϰϮϳ Ϭ͘ϬϬϭϲϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϯϬϳϳ Ϭ͘Ϭϭϵϴϰϴ Ϭ͘ϮϲϱϰϮϳ Ϭ͘Ϭϭϳϲϵϳ Ϭ͘ϭϲϵϵϭϲ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϮϰ Ϭ Ϭ͘ϬϬϬϲϱϯ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϳϵϰϭϰ͘ϰ ϱϯϯϳϳϳϮ ϱϯϯϳϳϳϮ Ϭ ϴϱϵϬϱϴ͘ϴ Ϭ͘Ϭϯϲϳϭϯ Ϭ Ϭ͘Ϯϯϲϴϴϱ Ϭ͘ϬϬϭϬϬϮ Ϭ Ϭ͘ϬϬϭϲϳϰ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϰϭ Ϭ͘ϬϬϭϬϵ Ϭ Ϭ͘ϬϬϭϴϮ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϯ ϯϬϰ͘ϳϯϲϯ Ϭ ϳϲ͘ϴϵϳϰϱ Ϭ͘ϬϬϭϳϮϱ Ϭ Ϭ͘Ϭϱϵϰϴϱ Ϭ͘ϬϬϯϵϴϮ Ϭ Ϭ͘ϬϯϬϯϲϳ Ϭ͘ϬϬϲϮϴϰ Ϭ Ϭ͘Ϯϲϰϰϰϵ Ϭ͘ϬϱϭϯϯϮ Ϭ͘ϭϯϱϯϰϯ Ϭ͘ϴϰϱϵϱϱ Ϭ͘ϬϬϵϭϳ Ϭ Ϭ͘Ϯϴϵϱϯϴ Ϭ͘ϬϱϭϯϯϮ Ϭ͘ϭϯϱϯϰϯ Ϭ͘ϴϰϱϵϱϱ Ϭ͘ϬϰϬϬϭϵ Ϭ͘ϱϳϮϯϳϲ Ϭ Ϯ͘ϳϵϴϬϵϱ Ϭ͘ϬϬϯϬϭϯ Ϭ Ϭ͘ϬϬϬϳϲ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲϴϵ͘ϰϮϮϯ ϮϬϮϲϯ͘ϯϱ ϮϬϮϲϯ͘ϯϱ Ϭ ϯϮϵϳ͘ϲϭϵ Ϭ͘ϬϯϭϳϬϭ Ϭ Ϭ Ϭ͘ϬϬϯϵϱϴ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϱϲ Ϭ͘ϬϬϰϭϯϳ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϳϱ Ϯϴϯ͘ϱϯϭϰ Ϭ Ϭ Ϭ͘ϬϬϬϱϰϳ Ϭ Ϭ Ϭ͘Ϭϰϰϲϳ Ϭ Ϭ Ϭ͘ϬϭϭϳϴϲϬϬϬϬϬϬ͘Ϭϭϯϰϭϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϭϱϳϮϱ Ϭ Ϭ Ϭ͘ϬϬϮϲϴϳ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϮϲϮϭ͘ϭϮϮ ϲϵϭϴϲ͘ϲϮ Ϭϲϵϭϴϲ͘ϲϮ ϭϯϮϭϬ͘ϱϭ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϵ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϲϳϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϮϲϴϲ͘ϰϵϱ ϴϵϱϯϬ͘Ϭϴ ϯϵϯϯϯ͘Ϭϯ ϱϬϭϵϳ͘Ϭϱ ϭϭϭϬϴ͘ϲϲ Ϭ͘ϬϬϮϴϮϮ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϲϳ Ϭ Ϭ͘ϬϬϭϰϭϱ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϲ Ϭ͘ϬϬϬϯϵϵ Ϭ Ϭ͘ϬϬϭϱϯϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϰϱ ϭϭϴ͘ϱϲϳϴ Ϭϳϭ͘ϵϭϳϱϵ Ϭ͘ϬϬϬϯϱϱ Ϭ Ϭ͘ϬϰϭϬϴϲ Ϭ͘ϬϬϬϰϱϵ Ϭ Ϭ͘ϬϭϵϬϳ Ϭ͘ϬϬϭϭϴϲ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϱϬϭϯ Ϭ͘ϬϮϮϮϴϰ Ϭ͘Ϯϴϯϲϯϰ Ϭ͘ϬϬϭϳϯϭ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϱϬϭϯ Ϭ͘ϬϮϮϮϴϰ Ϭ͘Ϯϴϯϲϯϰ Ϭ͘Ϭϭϴϰϰϰ Ϭ͘ϭϳϳϭϭϯ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϳϮ Ϭ Ϭ͘ϬϬϬϳϭϭ^ĂŶDĂƚĞŽ ϮϬϮϳ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϮϱϭϵ͘ϱϲ ϰϭϬϰϵϵ͘ϴ ϰϭϬϰϵϵ͘ϴ Ϭ ϭϴϲϱϮϮ͘ϴ Ϭ͘ϬϳϮϰϬϭ Ϭ͘ϬϯϬϲϲϳ Ϭ͘ϱϬϱϴϬϭ Ϭ͘ϬϬϭϯϬϱ Ϭ Ϭ͘ϬϬϬϭϴϰ Ϭ͘ϬϬϮ Ϭ͘ϬϮϳϯ Ϭ͘ϬϬϭϰϭϵ Ϭ Ϭ͘ϬϬϬϮ Ϭ͘ϬϬϴ Ϭ͘Ϭϳϴ ϴϬϮ͘ϲϮϲϭ ϭϭϯ͘ϰϱϴϯ Ϯϲ͘Ϭϱϰϳϴ Ϭ͘ϬϬϯϴϯϲ Ϭ͘Ϭϵϴϱϱϱ Ϭ͘ϬϮϱϬϮϯ Ϭ͘ϬϬϰϮϰϲ Ϭ͘ϬϬϮϳϭϵ Ϭ͘Ϭϰϯϳϳϱ Ϭ͘ϬϭϴϬϵϲ Ϭ͘ϯϱϭϳϰϲ Ϭ͘ϭϭϵϵϰϮ Ϭ͘ϬϮϳϳϮϱ Ϭ͘ϭϱϲϭϮϯ ϭ͘ϱϳϴϱϱϳ Ϭ͘ϬϮϲϰϬϲ Ϭ͘ϱϭϯϮϲϳ Ϭ͘ϭϯϭϯϮϮ Ϭ͘ϬϮϳϳϮϱ Ϭ͘ϭϱϲϭϮϯ ϭ͘ϱϳϴϱϱϳ Ϭ͘Ϭϰϰϵϴϳ Ϭ͘ϴϬϴϬϬϯ ϯ͘ϳϲϵϯϰϲ ϯ͘ϯϴϲϮϱ Ϭ͘ϬϬϳϵϯϱ Ϭ͘ϬϬϭϭϮϮ Ϭ͘ϬϬϬϮϱϴ^ĂŶDĂƚĞŽ ϮϬϮϳ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲϭϮϭ͘ϵϮϮ ϮϭϮϱϲϰ͘ϴ ϮϭϮϱϲϰ͘ϴ Ϭ ϳϳϬϬϲ͘Ϭϴ Ϭ͘ϲϲϳϭϳϴ ϭ͘ϯϰϴϱϭϴ Ϭ Ϭ͘Ϭϭϵϲϴϰ Ϭ͘ϬϮϲϱϮϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϮϳϯ Ϭ͘ϬϮϬϱϳϰ Ϭ͘ϬϮϳϳϮϲ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϳϴ ϲϭϱ͘ϱϳϲϱ ϭϮϮ͘ϭϴϲϴ Ϭ Ϭ͘ϬϬϱϭϭϰ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϬϵϲϵϴϰϬ͘ϬϭϵϮϱϭ Ϭ Ϭ͘ϭϭϬϬϵϮ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϮϱϯϯϯ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϯϭϮϭ Ϭ͘Ϯϲϭϴϱϱ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϱϴϯϯ Ϭ͘ϬϬϭϭϱϴ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϱϭϵ͘ϰϭϰϰ Ϯϱϰϴϴ͘ϵϭϬ Ϯϱϰϴϴ͘ϵϭ ϳϮϳϭ͘ϭϴϮ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϭϯϲϱϬϬϬϬ͘ϬϬϴϬ͘ϬϯϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϰϯϭ͘ϳϮϵ ϰϱϯϯϳ͘ϴϮ ϰϱϯϯϳ͘ϴϮ Ϭ ϮϭϯϯϬ͘ϲϯ Ϭ͘Ϭϳϳϲϰϯ Ϭ͘ϬϮϵϬϯϲ Ϭ͘ϰϵϴϰϵϲ Ϭ͘ϬϬϭϮϮϳ Ϭ Ϭ͘ϬϬϬϭϱϱ Ϭ͘ϬϬϮ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϬϭϯϯϰ Ϭ Ϭ͘ϬϬϬϭϲϴ Ϭ͘ϬϬϴ Ϭ͘Ϭϵϭ ϵϬϱ͘ϲϱϵϴ ϭϯϭ͘ϯϮϮϮ Ϯϰ͘ϲϭϴϳϴ Ϭ͘ϬϬϮϵϳϴϬ͘ϬϵϮϴϴϳ Ϭ͘ϬϮϯϵϴϱ Ϭ͘ϬϬϰϵϴϱ Ϭ͘ϬϬϮϱϬϴ Ϭ͘Ϭϰϭϱϵϴ Ϭ͘ϬϭϮϵϭϰ Ϭ͘ϯϯϯϭϴϭ Ϭ͘ϭϭϰϵϬϰ Ϭ͘ϬϮϴϮϴϴ Ϭ͘ϭϱϴϰϳϮ ϭ͘ϲϲϬϳϱϵ Ϭ͘Ϭϭϴϴϰϰ Ϭ͘ϰϴϲϭϳϳ Ϭ͘ϭϮϱϴϬϲ Ϭ͘ϬϮϴϮϴϴ Ϭ͘ϭϱϴϰϳϮ ϭ͘ϲϲϬϳϱϵ Ϭ͘Ϭϰϱ Ϭ͘ϲϴϳϮϬϰ ϯ͘ϳϳϯϮϰϵ ϯ͘ϯϭϳϭϱϭ Ϭ͘ϬϬϴϵϱϯ Ϭ͘ϬϬϭϮϵϴ Ϭ͘ϬϬϬϮϰϯ^ĂŶDĂƚĞŽ ϮϬϮϳ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϳϳϳ͘Ϭϯϳ ϵϰϵϴϲ͘ϱϯ ϵϰϵϴϲ͘ϱϯ Ϭ ϯϰϵϯϭ͘ϲϰ Ϭ͘ϱϯϵϱϰϯ ϭ͘Ϯϵϵϴϭϴ Ϭ Ϭ͘ϬϭϵϯϬϯ Ϭ͘ϬϮϲϳϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϮϬϭϳϲ Ϭ͘ϬϮϳϵϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϵϭ ϳϮϮ͘ϰϱϮ ϭϵϱ͘ϯϬϱ Ϭ Ϭ͘ϬϬϱϭϯϳ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϭϯϴϮϯ Ϭ͘ϬϯϬϳϳ Ϭ Ϭ͘ϭϭϬϱϵϯ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϮϱϵϬϮ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϴϯϱϴ Ϭ͘Ϯϰϲϰϭϲ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϲϴϰϲ Ϭ͘ϬϬϭϴϱϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϯϭ͘ϵϴϰ ϲϭϳϴ͘Ϯϴϯ Ϭϲϭϳϴ͘Ϯϴϯ ϭϳϱϬ͘ϳϮϰ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϰϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ Dz ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϱϯϲϭ͘ϳϴ ϴϭϵϭϬ͘ϰϳ ϴϭϵϭϬ͘ϰϳ Ϭ ϯϬϳϮϯ͘ϱϲ Ϭ͘ϰϴϳϬϲϱ Ϭ Ϭ͘ϭϬϯϯϰϭ Ϭ͘ϬϬϭϵϭϱ Ϭ Ϭ͘ϬϬϯϰϱϰ Ϭ͘ϬϬϭ Ϭ͘ϬϬϰϮ Ϭ͘ϬϬϮϬϱϭ Ϭ Ϭ͘ϬϬϯϲϴϴ Ϭ͘ϬϬϰ Ϭ͘ϬϭϮ ϭϴϱ͘ϳϳϯϮ Ϭ ϰϮ͘ϮϮϴϰϳ Ϭ͘ϭϯϰϳϴϱ Ϭ Ϭ͘ϭϱϱϰϮϭ Ϭ͘ϬϯϱϲϴϵϬ Ϭ͘ϬϬϲϯϳϲ Ϭ͘ϴϯϳϴϮϳ Ϭ ϭ͘ϭϮϰϯϱϵ ϯ͘ϱϰϯϱϮϱ ϯ͘ϲϵϰϱϲϭ Ϯ͘ϵϴϬϲϭϲ ϭ͘ϬϮϲϴϲϲ Ϭ ϭ͘ϮϮϯϬϵϭ ϯ͘ϱϰϯϱϮϱ ϯ͘ϲϵϰϱϲϭ Ϯ͘ϵϴϬϲϭϲ Ϭ͘ϬϬϵϬϭϱ ϭϬ͘ϭϰϳϰϱ Ϭ ϳ͘ϲϮϬϵϲϰ Ϭ͘ϬϬϭϴϯϳ Ϭ Ϭ͘ϬϬϬϰϭϳ^ĂŶDĂƚĞŽ ϮϬϮϳ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϬϬϴϱϯ͘ϵ ϯϬϳϮϯϯϰ ϯϬϳϮϯϯϰ Ϭ ϰϴϭϰϵϯ͘ϵ Ϭ͘ϬϰϬϲϯϵ Ϭ Ϭ͘Ϯϲϰϰϲϳ Ϭ͘ϬϬϬϵϴϵ Ϭ Ϭ͘ϬϬϭϲϵϱ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϲϭ Ϭ͘ϬϬϭϬϳϱ Ϭ Ϭ͘ϬϬϭϴϰϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϴϵ ϯϲϳ͘ϲϬϴ Ϭ ϵϯ͘ϭϵϲϵϴ Ϭ͘ϬϬϭϴϱϴ Ϭ Ϭ͘ϬϲϱϬϮϯ Ϭ͘ϬϬϰϭϵϵ Ϭ Ϭ͘ϬϯϭϲϭϮ Ϭ͘ϬϬϳϬϬϵ Ϭ Ϭ͘ϯϬϮϯϳϰ Ϭ͘Ϭϱϱϲϴϳ Ϭ͘ϭϱϮϰϮϮ Ϭ͘ϵϰϰϱϵϵ Ϭ͘ϬϭϬϮϮϳ Ϭ Ϭ͘ϯϯϭϬϲϭ Ϭ͘Ϭϱϱϲϴϳ Ϭ͘ϭϱϮϰϮϮ Ϭ͘ϵϰϰϱϵϵ Ϭ͘ϬϰϬϭϬϴ Ϭ͘ϱϴϱϳϮϳ Ϭ Ϯ͘ϵϬϬϳϰϱ Ϭ͘ϬϬϯϲϯϰϬ Ϭ͘ϬϬϬϵϮϭ^ĂŶDĂƚĞŽ ϮϬϮϳ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϯϬϲ͘ϳϮϮ ϯϴϭϴϮ͘ϲϭ ϯϴϭϴϮ͘ϲϭ Ϭ ϲϭϴϯ͘ϱϱϱ Ϭ͘ϬϮϱϰϬϵ Ϭ Ϭ Ϭ͘ϬϬϮϵϭϱ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϮϮ Ϭ͘ϬϬϯϬϰϳ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϲϰ ϯϳϰ͘ϰϰϯϰ Ϭ Ϭ Ϭ͘ϬϬϬϯϯϵ Ϭ Ϭ Ϭ͘Ϭϱϴϵϵϰ Ϭ Ϭ Ϭ͘ϬϬϳϯϬϲϬϬϬϬϬϬ͘ϬϬϴϯϭϴ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϱϴϮϲϵ Ϭ Ϭ Ϭ͘ϬϬϯϱϰϴ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϮϳϳϬ͘ϴϵϮ ϳϯϬϮϵ͘Ϯϰ Ϭ ϳϯϬϮϵ͘Ϯϰ ϭϯϵϱϵ͘ϬϱϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϵ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϲϴϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϭϱϴϬ͘ϱϲϲ ϱϰϰϲϰ͘ϴϯ Ϯϯϴϱϯ͘ϳϰ ϯϬϲϭϭ͘Ϭϵ ϲϱϯϱ͘ϲϯϵ Ϭ͘ϬϬϮϴϭϰ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϴϳ Ϭ Ϭ͘ϬϬϭϱϬϯ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϳ Ϭ͘ϬϬϬϰϮϭ Ϭ Ϭ͘ϬϬϭϲϯϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϰϴ ϭϭϴ͘ϮϬϭϮ Ϭϴϳ͘ϱϴϬϴϴ Ϭ͘ϬϬϬϯϱϱ Ϭ Ϭ͘ϬϰϭϮϰϯ Ϭ͘ϬϬϬϰϲϮ Ϭ Ϭ͘ϬϭϵϮϭϲ Ϭ͘ϬϬϭϭϴϯ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϳϭϵϴ Ϭ͘ϬϮϰϲ Ϭ͘ϯϬϯϭϱ Ϭ͘ϬϬϭϳϮϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϳϭϵϴ Ϭ͘ϬϮϰϲ Ϭ͘ϯϬϯϭϱ Ϭ͘ϬϭϴϯϵϱϬ͘ϭϳϲϱϲϴ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϲϵ Ϭ Ϭ͘ϬϬϬϴϲϲ^ĂŶDĂƚĞŽ ϮϬϮϳ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϴϵ͘ϳϮϳϱ ϴϰϴϮ͘ϯϰϯ ϴϰϴϮ͘ϯϰϯ Ϭ ϴϵ͘ϬϬϴϯϰ Ϭ͘ϮϬϱϱϵϴ Ϭ Ϭ͘ϯϵϰϯϰϭ Ϭ͘ϬϬϭϰϳϳ Ϭ Ϭ͘ϬϬϬϯϳϰ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϲϬϲ Ϭ Ϭ͘ϬϬϬϰϬϳ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϵϰϱ͘ϲϬϮ Ϭ ϯϬ͘ϵϭϵϰϰ Ϭ͘ϬϬϳϲϳϳ Ϭ Ϭ͘Ϭϯϰϰϴϭ Ϭ͘Ϭϭϲϰϳϭ Ϭ Ϭ͘ϬϰϰϱϬϲ Ϭ͘ϬϮϵϭϭϭ Ϭ Ϭ͘ϭϯϲϱϱϰ ϲ͘ϰϵϳϬϯϰ Ϭ͘ϭϱϲϴϭϯ Ϯ͘ϰϭϰϯϭϳ Ϭ͘ϬϰϮϰϳϴ ϬϬ͘ϭϰϵϱϬϵ ϲ͘ϰϵϳϬϯϰ Ϭ͘ϭϱϲϴϭϯ Ϯ͘ϰϭϰϯϭϳ Ϭ͘Ϭϰϰϵϴϭ Ϭ͘ϱϵϮϭϱϱ Ϭ ϯ͘ϬϴϰϮϰϯ Ϭ͘ϬϭϵϮϯϰ Ϭ Ϭ͘ϬϬϬϯϬϲ^ĂŶDĂƚĞŽ ϮϬϮϳ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϯϴ͘ϵϭϭϳ ϰϭϱϯ͘ϴϱϴ ϰϭϱϯ͘ϴϱϴϬ ϰϯ͘ϴϵϭϭϳ Ϯ͘ϴϯϮϬϱϰ Ϭ Ϭ Ϭ͘Ϭϯϳϰϲϰ Ϭ Ϭ Ϭ͘ϬϬϰ Ϭ͘Ϭϭϱϲϳϱ Ϭ͘Ϭϯϵϭϱϴ Ϭ Ϭ Ϭ͘Ϭϭϲ Ϭ͘Ϭϰϰϳϴϱ ϭϬϴϲ͘ϳϬϭ Ϭ Ϭ Ϭ͘ϬϬϯϵϯϱ Ϭ Ϭ Ϭ͘ϭϳϭϮϭ Ϭ Ϭ Ϭ͘ϬϴϰϳϮϲϬϬϬϬϬϬ͘Ϭϵϲϰϱϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϬϲϱ Ϭ͘ϮϱϴϮϵϰ Ϭ Ϭ Ϭ͘ϬϭϬϮϵϳ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϲϳ͘ϱϮϰϭ ϰϴϯϵϬ͘ϱϲ ϰϴϯϵϬ͘ϱϲ Ϭ ϭϳϯϱϳ͘ϰϮ Ϭ͘ϮϮϳϱϳϴ Ϭ͘Ϭϳϴϵϴϵ Ϭ͘ϯϴϲϯϰϭ Ϭ͘ϬϬϭϯϰϳ Ϭ Ϭ͘ϬϬϬϰϴϱ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϰϲϱ Ϭ Ϭ͘ϬϬϬϱϮϴ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϲϴϬ͘ϯϯϯ ϱϬϳ͘ϳϱϰϱ ϰϮ͘ϲϳϮϰϭ Ϭ͘ϬϬϳϰϳϱ Ϭ͘ϮϳϭϬϭϰ Ϭ͘ϬϰϮϭϬϮ Ϭ͘ϬϭϯϲϮϲ Ϭ͘ϬϬϳϬϲϭ Ϭ͘ϬϯϮϳϭϭ Ϭ͘Ϭϯϰϲϴϲ ϭ͘ϬϮϭϮϭϵ Ϭ͘Ϯϭϵϵϭϴ Ϭ͘ϬϮϮϭϰϵ Ϭ͘ϭϴϰϴϰϲ ϭ͘ϳϴϱϲϴϱ Ϭ͘ϬϱϬϲϭϰ ϭ͘ϰϵϬϭϲϭ Ϭ͘ϮϰϬϳϴϮ Ϭ͘ϬϮϮϭϰϵ Ϭ͘ϭϴϰϴϰϲ ϭ͘ϳϴϱϲϴϱ Ϭ͘Ϭϰϱ Ϭ͘ϲϳϴϱϯϭ ϭϱ͘ϮϭϱϮϱ ϰ͘ϳϲϭϴϳ Ϭ͘ϬϭϲϲϭϮ Ϭ͘ϬϬϱϬϮ Ϭ͘ϬϬϬϰϮϮ^ĂŶDĂƚĞŽ ϮϬϮϳ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϯϴϭ͘ϰϱϲ ϭϳϳϰϱϭ͘ϭ ϭϳϳϰϱϭ͘ϭ Ϭ ϱϮϵϲϱ͘Ϯϱ Ϭ͘ϵϴϬϭϮ ϭϭ͘ϱϳϱϰϯ ϭ͘ϲϬϵϰϲϰ Ϭ͘ϬϭϬϯϮ Ϭ͘ϬϭϴϲϬϴ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϵϴϯϬ͘ϬϭϬϳϴϳ Ϭ͘Ϭϭϵϰϰϵ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϲϲϰ ϭϭϯϭ͘ϵϰϯ Ϯϭϴϵ͘ϳϯϮ Ϭ Ϭ͘ϬϬϭϭϭϰ Ϭ͘ϬϭϬϭϳϴϬ Ϭ͘ϭϳϴϯϯϴ Ϭ͘ϯϰϰϵϵϯ Ϭ Ϭ͘ϬϮϯϵϳϳ Ϭ͘ϮϭϵϭϮϳϬϬϬϬϬ͘ϬϮϳϮϵϲ Ϭ͘ϮϰϵϰϲϬϬϬϬϬ͘ϮϭϯϬϴϭ Ϭ͘Ϭϵϴϰϭϱ ϳ͘ϰϵϰϬϯϲ Ϭ Ϭ͘ϬϭϬϳϭϵ Ϭ͘ϬϮϬϳϯϱ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϭϮϳ͘ϳϴϬϮ ϳϬϯϮ͘ϲϭϲ ϬϳϬϯϮ͘ϲϭϲ ϭϳϲϵ͘ϲϰϴϬϬϬϬϬϬϬ͘ϬϬϯϬ͘ϬϬϳϵϱϭ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϳϭϴϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϱϭ͘ϱϱϬϰ ϮϮϵϲ͘ϲϰϰ ϮϮϵϲ͘ϲϰϰ Ϭ ϰϳϵ͘ϰϰϳϰ Ϭ͘ϭϬϳϰϵϲ ϲ͘ϰϯϮϴϳϲ Ϭ Ϭ͘ϬϬϭϯϱϮ Ϭ͘Ϭϭϵϴϳϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϲϬϴϴ Ϭ͘ϬϬϭϰϳϭ Ϭ͘ϬϮϭϲϮϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϵϲϱ ϵϴϲ͘Ϯϰϴϲ ϱϯϴϭ͘ϯϳϰ Ϭ Ϭ͘ϳϴϬϮϯϳ ϭϲ͘ϰϯϮϲϲ Ϭ Ϭ͘ϮϬϭϬϱϯ ϭ͘ϬϵϳϬϮϴ Ϭ Ϭ͘Ϭϭϭϭϰϴ Ϭ͘Ϯϯϰϳϵ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϳϵϲϮϴϵ ϭϲ͘ϳϳϬϳϯ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘Ϭϲϭϯϳϲ ϯϴ͘ϲϳϲϵϰ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϰϴ͘ϮϭϬϭ ϭϮϰϳϯ͘ϳϳ ϭϮϰϳϯ͘ϳϳ Ϭ ϰϵϲϲ͘ϭϴϴ Ϭ͘Ϯϭϭϯϭϭ Ϭ͘ϬϲϬϭϵϮ Ϭ͘ϯϱϳϭϵϯ Ϭ͘ϬϬϭϬϵ Ϭ Ϭ͘ϬϬϬϮϵ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϲϴ Ϭ͘ϬϬϭϭϴϲ Ϭ Ϭ͘ϬϬϬϯϭϱ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϳϵϵ ϭϲϳϭ͘ϰϰϭ ϯϲϮ͘ϴϰϵϰ Ϯϵ͘ϭϴϱϴϴ Ϭ͘ϬϬϲϰϱϲϬ͘ϮϬϯϵϮϴ Ϭ͘Ϭϯϭϲϲϲ Ϭ͘ϬϭϯϬϲϲ Ϭ͘ϬϬϱϰϭϯ Ϭ͘ϬϯϬϲϬϲ Ϭ͘ϬϮϵϮϱϰ Ϭ͘ϳϰϳϳϵϴ Ϭ͘ϭϱϳϰϴϬ͘ϬϮϱϵϱϯ Ϭ͘ϭϮϳϬϮϵ Ϯ͘ϭϳ Ϭ͘ϬϰϮϲϴϳ ϭ͘Ϭϵϭϭϴϰ Ϭ͘ϭϳϮϰϮϭ Ϭ͘ϬϮϱϵϱϯ Ϭ͘ϭϮϳϬϮϵ Ϯ͘ϭϳ Ϭ͘Ϭϰϰϵϳϱ Ϭ͘ϲϭϭϱϬϯ ϱ͘ϳϴϯϴϬϯ ϯ͘ϮϰϯϬϵϰ Ϭ͘ϬϭϲϱϮϰ Ϭ͘ϬϬϯϱϴϳ Ϭ͘ϬϬϬϮϴϵ^ĂŶDĂƚĞŽ ϮϬϮϳ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϭϳϵ͘ϰϲϳ ϳϱϵϬϵ͘ϵϲ ϳϱϵϬϵ͘ϵϲ Ϭ ϭϭϱϳϱ͘ϰϰ Ϭ͘ϳϳϱϭϵϲ ϱ͘Ϯϰϭϰϭϵ ϭ͘ϰϲϲϴϬϮ Ϭ͘ϬϬϴϴϳϯ Ϭ͘ϬϬϮϵϴϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϳϰϯϱ Ϭ͘ϬϬϵϮϳϰ Ϭ͘ϬϬϯϭϮϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϵϴϭϰ ϭϮϬϬ͘ϭϭϱ ϭϭϵϯ͘ϴϯ Ϭ Ϭ͘ϬϬϬϴϳϴ Ϭ͘ϬϭϰϯϲϮ Ϭ Ϭ͘ϭϴϵϬϳϵ Ϭ͘ϭϴϴϬϴϴ Ϭ Ϭ͘ϬϭϴϵϬϯ Ϭ͘ϯϬϵϮϭϲϬϬϬϬϬ͘ϬϮϭϱϭϵ Ϭ͘ϯϱϮϬϭϵ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϭϴϬϭϯ Ϭ͘ϬϵϬϮϵϮ ϱ͘ϳϲϱϲϴϮ Ϭ Ϭ͘Ϭϭϭϯϲϰ Ϭ͘ϬϭϭϯϬϱ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϱ͘ϳϮϬϮϯϯ ϰϱϲ͘ϯϴϲϲ Ϭϰϱϲ͘ϯϴϲϲ ϭϭϰ͘ϰϱϬϰ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϬϳϴϰ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϯϵϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϭ͘ϱϴϴϲϭ ϳϰϳ͘ϱϯϰϮ ϳϰϳ͘ϱϯϰϮ Ϭ ϭϬϯ͘ϭϯϴϲ Ϭ͘ϭϮϵϴϬϳ ϭ͘ϱϭϯϯϲϰ Ϭ Ϭ͘ϬϬϭϯϰϵ Ϭ͘ϬϬϰϰϳϯ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϲϭϰϴ Ϭ͘ϬϬϭϰϲϳ Ϭ͘ϬϬϰϴϲϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϲϭϯϳ ϵϲϯ͘ϲϭϴϱ ϭϭϴϲ͘ϵϱ Ϭ Ϭ͘ϴϮϮϵϮϮ ϯ͘ϵϯϵϵϱϲ Ϭ Ϭ͘ϭϵϲϰϰ Ϭ͘Ϯϰϭϵϲϴ Ϭ Ϭ͘Ϭϭϭϳϱϴ Ϭ͘ϬϱϲϮϵϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϴϯϵϴϱϯ ϰ͘ϬϮϭϬϭϰ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘ϯϰϯϱϳϮ ϴ͘ϲϰϲϰϴϮ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϳϵ͘ϰϵϲϵϮ ϯϴϴϯ͘ϱϬϯ ϯϴϴϯ͘ϱϬϯ Ϭ ϯϭϳ͘ϵϴϳϳ Ϭ͘ϲϯϮϰϴϭ Ϭ͘ϴϮϮϯϬϳ Ϭ͘ϲϬϬϳϰϮ Ϭ͘ϬϬϭϬϳϵ Ϭ Ϭ͘ϬϬϬϳϮϭ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϭϭϳϰ Ϭ Ϭ͘ϬϬϬϳϴϰ Ϭ͘ϬϬϴ Ϭ͘Ϭϰϰϵϭϳ ϳϲϵ͘ϵϵϱ Ϯϰϲϱ͘ϴϯϱ ϱϳ͘ϱϱϮϭϰ Ϭ͘ϬϭϰϬϴϭ Ϯ͘ϰϰϴϭϰϱ Ϭ͘ϬϴϬϯϲϳ Ϭ͘ϬϯϬϴϰ Ϭ͘Ϭϳϴϱϯϵ Ϭ͘Ϭϱϱϱϯϱ Ϭ͘Ϭϲϴϴϴϳ ϭϬ͘ϲϯϯϮϭ Ϭ͘ϰϲϰϰϭϲ Ϭ͘ϭϭϮϴϰϵ Ϭ͘ϯϱϳϯϳϲ ϭ͘ϵϰϲϳϬϲ Ϭ͘ϭϬϬϱϭϵ ϭϱ͘ϱϭϱϵϲ Ϭ͘ϱϬϴϰϳϳ Ϭ͘ϭϭϮϴϰϵ Ϭ͘ϯϱϳϯϳϲ ϭ͘ϵϰϲϳϬϲ Ϭ͘Ϭϰϱ ϭ͘ϳϴϬϭϰϳ ϴϮ͘ϭϵϬϰϰ ϭϭ͘Ϯϭϯϳϳ Ϭ͘ϬϬϳϲϭϮ Ϭ͘ϬϮϰϯϳϳ Ϭ͘ϬϬϬϱϲϵ^ĂŶDĂƚĞŽ ϮϬϮϳ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϲϳ͘ϱϲϰϭ ϯϳϬϲ͘ϴϳϴ ϯϳϬϲ͘ϴϳϴ Ϭ ϮϰϮϲ͘ϯϮϴ ϯ͘ϳϵϯϰϳϳ ϮϬ͘ϲϭϰϭϲ Ϭ͘ϱϭϮϴ Ϭ͘Ϭϭϴϯϵϭ Ϭ͘Ϭϭϳϵϭϱ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭϬ͘ϬϭϵϮϮϯ Ϭ͘ϬϭϴϳϮϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϭϮϴ͘ϱϴϯ ϮϮϬϭ͘ϳϳϲ Ϭ Ϭ͘ϬϬϮϳϯϭ Ϭ͘ϬϬϴϬϬϯϬ Ϭ͘ϭϳϳϴϬϵ Ϭ͘ϯϰϲϴϵϭ Ϭ Ϭ͘Ϭϱϴϳϵϳ Ϭ͘ϭϳϮϮϵϵϬϬϬϬϬ͘Ϭϲϲϵϯϲ Ϭ͘ϭϵϲϭϰϵ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϱϰϯϱ Ϭ͘ϭϴϮϰϲϯ ϰ͘ϴϮϴϯϮϵ Ϭ Ϭ͘ϬϭϬϲϴϳ Ϭ͘ϬϮϬϴϱ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϱ͘ϯϭϬϳϰϭ ϮϬϮ͘ϴϯϭϰ ϬϮϬϮ͘ϴϯϭϰ ϰϳ͘ϴϳϲϵϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮϯϯϯ Ϭ͘ϬϬϳϴϲ Ϭ Ϭ Ϭ Ϭ͘ϬϬϵϯϯϮ Ϭ͘ϬϮϮϰϱϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϳ͘Ϭϱϯϲϳϵ ϭϳϮ͘ϱϬϭϳ ϭϳϮ͘ϱϬϭϳ Ϭ ϭϬϮ͘ϭϯϳϯ Ϭ͘ϰϴϭϳϰϯ ϱ͘Ϯϭϵϲϵϱ Ϭ Ϭ͘ϬϬϯϯϳϴ Ϭ͘ϬϭϮϱϳϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϯϲϳϰ Ϭ͘Ϭϭϯϲϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϮϮϬ͘ϯϬϱ ϰϭϬϴ͘ϵϴϲ Ϭ ϯ͘ϮϬϮϳϴϴ ϭϰ͘ϲϮϰϰϵ Ϭ Ϭ͘Ϯϰϴϳϲϳ Ϭ͘ϴϯϳϲϰϰ Ϭ Ϭ͘ϬϰϱϳϲϮ Ϭ͘ϮϬϴϵϱϱϬϬϬϬϯ͘Ϯϲϴϲϴ ϭϰ͘ϵϮϱϯϳϬϬϬϬϭ͘ϬϲϭϬ͘ϱϰϴϯϳ Ϯϯ͘ϱϬϬϱϭ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϭ͘ϵϴϱϯϯ ϰϮϭϰ͘ϱϲϰ ϰϮϭϰ͘ϱϲϰ Ϭ Ϯϰϳ͘ϵϰϭϯ Ϭ͘ϬϯϲϬϰϭ Ϭ Ϭ͘ϯϴϬϴϬϰ Ϭ͘ϬϬϭϭϴϲ Ϭ Ϭ͘ϬϬϬϭϲϯ Ϭ͘ϬϬϮϬϳϮ Ϭ͘ϬϯϮϯϯϮϬ͘ϬϬϭϮϵ Ϭ Ϭ͘ϬϬϬϭϳϳ Ϭ͘ϬϬϴϮϵ Ϭ͘ϬϵϮϯϳϳ ϵϱϰ͘ϯϯϰϯ Ϭ ϯϴ͘ϴϮϭϯϳ Ϭ͘ϬϬϭϳϲϴ Ϭ Ϭ͘Ϭϯϲϳϲϲ Ϭ͘ϬϬϰϲϳϱ Ϭ Ϭ͘ϬϱϳϮϰϵ Ϭ͘ϬϬϰϵϴϲ Ϭ Ϭ͘ϭϯϯϯϬϲ Ϭ͘ϬϯϮϲϯϲ Ϭ͘ϭϬϮϳϬϯ Ϭ͘ϰϬϳϵϱϴ Ϭ͘ϬϬϳϮϳϱ Ϭ Ϭ͘ϭϰϱϵϱϯ Ϭ͘ϬϯϮϲϯϲ Ϭ͘ϭϬϮϳϬϯ Ϭ͘ϰϬϳϵϱϴ Ϭ͘Ϭϰϱ Ϭ͘ϱϲϱϬϮϯ Ϭ ϲ͘ϰϯϬϵϳ Ϭ͘ϬϬϵϰϯϱ Ϭ Ϭ͘ϬϬϬϯϴϰ^ĂŶDĂƚĞŽ ϮϬϮϳ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϳϵ͘ϮϰϳϮ ϮϭϲϬϳ͘Ϯϱ ϮϭϲϬϳ͘Ϯϱ Ϭ ϭϭϭϲ͘ϵϴϵ Ϭ͘ϯϳϱϱϮϵ Ϭ Ϭ Ϭ͘ϬϬϲϴϮϲ Ϭ Ϭ Ϭ͘ϬϬϴϬϵϲ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϳϭϯϱ Ϭ Ϭ Ϭ͘ϬϯϮϯϴϱϬ͘ϭϭ ϭϮϮϯ͘ϰϬϱ Ϭ Ϭ Ϭ͘ϬϬϯϭϰϱ Ϭ Ϭ Ϭ͘ϭϵϮϳϰϴ Ϭ Ϭ Ϭ͘ϬϲϳϳϭϰϬϬϬϬϬϬ͘ϬϳϳϬϴϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϮ Ϭ͘Ϭϳϳϭϴϴ Ϭ Ϭ Ϭ͘ϬϭϭϱϵϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϳ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯϴ͘ϭϭϵϯϴ ϯϵϯϰ͘Ϯϳϯ Ϭϯϵϯϰ͘Ϯϳϯ ϭϱϮ͘ϰϳϳϱϬϬϬϬϬϬϬ͘ϬϬϳϯϳϳ Ϭ͘ϬϭϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϮϵϱϬϳ Ϭ͘ϬϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϳ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϲϱ͘ϵϯϭϬϱ ϰϱϲϲ͘ϴϴϳ ϰϱϲϲ͘ϴϴϳ Ϭ Ϯϲϯ͘ϳϮϰϮ Ϭ͘Ϭϱϱϰϰϱ Ϭ Ϭ Ϭ͘ϬϬϬϮϳϮ Ϭ Ϭ Ϭ͘ϬϬϳϳϰϰ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϬϮϴϱ Ϭ Ϭ Ϭ͘ϬϯϬϵϳϰ Ϭ͘ϭϭ ϭϮϲϮ͘ϴϴϰ Ϭ Ϭ ϰ͘ϭϬϭϰϯϴ Ϭ Ϭ Ϭ͘Ϯϱϳϰϰϳ Ϭ Ϭ Ϭ͘ϬϱϴϲϬϭϬϬϬϬϬϰ͘ϭϴϱϴϭϴ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϵϳ ϰϲ͘ϱϮϮϭϲ Ϭ Ϭ Ϭ Ϭ Ϭ ^ŽƵƌĐĞ͗D&ϮϬϮϭ;ǀϭ͘Ϭ͘ϮͿŵŝƐƐŝŽŶZĂƚĞƐZĞŐŝŽŶdǇƉĞ͗ŽƵŶƚǇZĞŐŝŽŶ͗^ĂŶDĂƚĞŽĂůĞŶĚĂƌzĞĂƌ͗ϮϬϮϴ^ĞĂƐŽŶ͗ŶŶƵĂůsĞŚŝĐůĞůĂƐƐŝĨŝĐĂƚŝŽŶ͗D&ϮϬϬϳĂƚĞŐŽƌŝĞƐhŶŝƚƐ͗ŵŝůĞƐͬĚĂǇĨŽƌsDdĂŶĚsDd͕ƚƌŝƉƐͬĚĂǇĨŽƌdƌŝƉƐ͕ŐͬŵŝůĞĨŽƌZhEy͕WDtĂŶĚWDdt͕ŐͬƚƌŝƉĨŽƌ^dZy͕,Kd^K<ĂŶĚZhE>K^^͕ŐͬǀĞŚŝĐůĞͬĚĂǇĨŽƌ/>yĂŶĚ/hZE͘W,sĐĂůĐƵůĂƚĞĚďĂƐĞĚŽŶƚŽƚĂůsDd͘ZĞŐŝŽŶ ĂůĞŶĚĂƌz sĞŚŝĐůĞĂƚDŽĚĞůzĞĂ ^ƉĞĞĚ &ƵĞů WŽƉƵůĂƚŝŽŶdŽƚĂůsDd sDd sDd dƌŝƉƐ EKǆͺZhEEKǆͺ/>yEKǆͺ^dZyWDϮ͘ϱͺZh WDϮ͘ϱͺ/>WDϮ͘ϱͺ^dZWDϮ͘ϱͺWDWDϮ͘ϱͺWDWDϭϬͺZhEWDϭϬͺ/>WDϭϬͺ^dZ WDϭϬͺWDdWDϭϬͺWDKϮͺZhEKϮͺ/>yKϮͺ^dZy,ϰͺZhE,ϰͺ/>y,ϰͺ^dZyEϮKͺZhEEϮKͺ/>yEϮKͺ^dZyZK'ͺZhEZK'ͺ/>yZK'ͺ^dZyZK'ͺ,Kd^ZK'ͺZhE>ZK'ͺ/hZdK'ͺZhEdK'ͺ/>ydK'ͺ^dZydK'ͺ,Kd^dK'ͺZhE>dK'ͺ/hZ E,ϯͺZhEKͺZhEyKͺ/>y Kͺ^dZy ^KǆͺZhE ^Kǆͺ/>y ^Kǆͺ^dZy^ĂŶDĂƚĞŽ ϮϬϮϴ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϰ͘Ϭϴϳϯϲϵ ϰϮϲ͘ϵϴϱϭ ϰϮϲ͘ϵϴϱϭ Ϭ ϴϭ͘ϳϴϬϬϵ ϯ͘ϳϴϱϵϮϯ Ϭ Ϭ͘ϬϬϬϳϰϯ Ϭ͘ϬϬϭϯϱϵ Ϭ Ϭ͘ϬϬϬϱϲϵ Ϭ͘ϬϬϱ Ϭ͘Ϭϯϭϭϱϯ Ϭ͘ϬϬϭϰϳϴ Ϭ Ϭ͘ϬϬϬϲϭϴ Ϭ͘ϬϮ Ϭ͘ϬϴϵϬϬϵ Ϯϭϲϵ͘ϲϬϱ Ϭ ϰϵ͘ϳϮϮϳϵ Ϭ͘ϭϬϵϲϵϲ Ϭ ϴ͘ϲϱͲϬϱ Ϭ͘ϭϰϴϰϵϳ Ϭ ϰ͘ϴϰͲϬϱ Ϭ͘ϱϯϮϵϳϰ Ϭ Ϭ͘ϬϬϬϰϲϵ Ϭ͘ϬϮϲϲϱ Ϭ͘ϭϵϮϴϴϱ ϭ͘ϴϮϴϰϲϰ Ϭ͘ϳϳϳϳϭϰ ϬϬ͘ϬϬϬϱϭϯ Ϭ͘ϬϮϲϲϱ Ϭ͘ϭϵϮϴϴϱ ϭ͘ϴϮϴϰϲϰ Ϭ͘Ϭϰϱ ϯϯ͘ϲϬϳϬϱ Ϭ ϰ͘Ϯϵϵϳϴϳ Ϭ͘ϬϮϭϰϰϵ Ϭ Ϭ͘ϬϬϬϰϵϮ^ĂŶDĂƚĞŽ ϮϬϮϴ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϯϰϴ͘ϳ ϭϭϴϴϲϯ͘ϲ ϭϭϴϴϲϯ͘ϲϬ ϭϱϭϭϴ͘ϴϳ Ϯ͘ϯϬϱϳϱϵ ϰϮ͘ϱϰϳϭϮ ϯ͘ϬϲϮϬϬϭ Ϭ͘ϬϮϯϴϵ Ϭ͘ϬϮϳϲϲϲ Ϭ Ϭ͘ϬϬϴϲϬϵ Ϭ͘ϬϯϬϭϱϭ Ϭ͘ϬϮϰϵϳ Ϭ͘ϬϮϴϵϭϳ Ϭ Ϭ͘Ϭϯϰϰϯϱ Ϭ͘Ϭϴϲϭϰϰ ϭϲϴϴ͘ϰϴϮ ϳϴϳϭ͘Ϯϴϯ Ϭ Ϭ͘ϬϬϭϬϲϴ Ϭ͘ϭϲϬϱϳϰ Ϭ Ϭ͘ϮϲϲϬϮϭ ϭ͘ϮϰϬϭϮϰ Ϭ Ϭ͘ϬϮϮϵϴϯ ϯ͘ϰϱϳϭϭϯϬϬϬϬϬ͘ϬϮϲϭϲϱ ϯ͘ϵϯϱϲϲϬϬϬϬϬ͘ϮϬϱϮϵ Ϭ͘Ϭϵϵϲϲϵ ϰϵ͘ϭϵϵϯϲ Ϭ Ϭ͘Ϭϭϱϵϴϵ Ϭ͘Ϭϳϰϱϯϲ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϰϮ͘ϲϭϵϭϯ ϯϵϬϬ͘ϲϵϭ ϬϯϵϬϬ͘ϲϵϭ ϰϭϬ͘ϲϯϲϯϬϬϬϬϬϬϬ͘ϬϬϴϰϳϮ Ϭ͘Ϭϭϳϲϯϲ Ϭ Ϭ Ϭ Ϭ͘Ϭϯϯϴϴϲ Ϭ͘ϬϱϬϯϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ ,,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϮϬϳ͘Ϯϲϭϭ ϭϯϮϳϳ͘ϱϰ ϭϯϮϳϳ͘ϱϰ Ϭ ϭϯϰϬ͘Ϯϵϲ Ϭ͘ϵϴϲϭϭϱ ϳ͘ϯϳϮϯϭϲ Ϭ Ϭ͘ϬϬϭϱϬϳ Ϭ͘ϬϭϮϮϮϭ Ϭ Ϭ͘ϬϬϵ Ϭ͘ϬϲϮϬϵϭ Ϭ͘ϬϬϭϲϯϵ Ϭ͘ϬϭϯϮϵϮ Ϭ Ϭ͘Ϭϯϲ Ϭ͘ϭϳϳϰϬϯ ϭϰϭϲ͘ϲϭϭ ϴϬϲϯ͘ϵϵϯ Ϭ Ϯ͘ϭϰϵϮϴϵ ϭϴ͘ϵϱϵϳ Ϭ Ϭ͘Ϯϴϴϳϴϱ ϭ͘ϲϰϯϴϵϴ Ϭ Ϭ͘Ϭϰϰϰϱ Ϭ͘ϮϵϰϱϱϰϬϬϬϬϮ͘ϮϬϵϭϲϮ ϭϵ͘ϯϳϲϳϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϳϬϭϮϭϱ ϭϯ͘ϵϮϯϱϭ ϱϵ͘ϯϰϴϯ Ϭ Ϭ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϮϯϴϮϮϰ ϲϲϮϱϬϵϲ ϲϲϮϱϬϵϲ Ϭϭϭϭϳϭϴϭ Ϭ͘ϬϮϳϳϯϭ Ϭ Ϭ͘ϮϭϬϬϳϰ Ϭ͘ϬϬϬϵϱϭ Ϭ Ϭ͘ϬϬϭϲϲϱ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϰϴ Ϭ͘ϬϬϭϬϯϰ ϬϬ͘ϬϬϭϴϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϳϭ ϮϱϬ͘ϱϮϮϭ Ϭ ϲϯ͘ϭϳϯϭ Ϭ͘ϬϬϭϰϯϯ Ϭ Ϭ͘Ϭϱϯϴϰϵ Ϭ͘ϬϬϯϱϮϮ Ϭ Ϭ͘ϬϮϳϳϮϴ Ϭ͘ϬϬϱϭϵϴ Ϭ Ϭ͘Ϯϰϱϲϭϳ Ϭ͘ϬϳϭϯϲϮ Ϭ͘ϭϵϰϰϵ ϭ͘ϭϲϱϲϯϴ Ϭ͘ϬϬϳϱϴϰ Ϭ Ϭ͘ϮϲϴϵϭϵϬ͘ϬϳϭϯϲϮ Ϭ͘ϭϵϰϰϵ ϭ͘ϭϲϱϲϯϴ Ϭ͘Ϭϯϴϴϳϭ Ϭ͘ϱϮϳϭϱ Ϭ Ϯ͘ϱϵϰϵϰϮ Ϭ͘ϬϬϮϰϳϳ Ϭ Ϭ͘ϬϬϬϲϮϱ^ĂŶDĂƚĞŽ ϮϬϮϴ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϱϭϴ͘ϮϲϮϯ ϭϬϰϮϮ͘ϳϯ ϭϬϰϮϮ͘ϳϯ Ϭ Ϯϭϴϱ͘ϵϬϳ Ϭ͘ϭϬϴϱϱϰ Ϭ Ϭ Ϭ͘ϬϬϳϲϬϰ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϰϭϴ Ϭ͘ϬϬϳϵϰϴ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϲϵϭ ϮϮϭ͘ϯϴϲϭ Ϭ Ϭ Ϭ͘ϬϬϬϳϮϱ Ϭ Ϭ Ϭ͘Ϭϯϰϴϳϵ Ϭ Ϭ Ϭ͘ϬϭϱϲϬϴϬϬϬϬϬϬ͘Ϭϭϳϳϲϵ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘Ϯϱϱϳϴϵ Ϭ Ϭ Ϭ͘ϬϬϮϬϵϴ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϮϮϵϰϯ͘Ϯϯ ϳϳϴϳϬϯ͘ϯ Ϭ ϳϳϴϳϬϯ͘ϯ ϭϭϮϭϰϲ͘Ϯ ϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϮ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ > ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϵϭϳϰ͘ϰϱϯ ϮϴϳϬϲϳ͘ϱ ϭϯϬϭϱϬ͘ϰ ϭϱϲϵϭϳ͘ϭ ϯϳϵϯϲ͘ϯϲ Ϭ͘ϬϬϮϵϭϯ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϰϯϰ Ϭ Ϭ͘ϬϬϭϲϯ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϮ Ϭ͘ϬϬϬϰϳϮ Ϭ Ϭ͘ϬϬϭϳϳϯ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϯϯ ϭϮϮ͘ϯϱϬϵ Ϭ ϲϭ͘Ϭϰϴϵϯ Ϭ͘ϬϬϬϯϲϰ Ϭ Ϭ͘ϬϰϬϵϭϱ Ϭ͘ϬϬϬϰϳ Ϭ Ϭ͘Ϭϭϴϵϭϭ Ϭ͘ϬϬϭϮϮϰ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϯϵϭϮϳ Ϭ͘ϬϰϮϯϵϵ Ϭ͘ϰϰϯϳϴϴ Ϭ͘ϬϬϭϳϴϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϯϵϭϮϳ Ϭ͘ϬϰϮϯϵϵ Ϭ͘ϰϰϯϳϴϴ Ϭ͘Ϭϭϴϱϭϵ Ϭ͘ϭϴϮϳϯϮ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϮϭ Ϭ Ϭ͘ϬϬϬϲϬϰ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϲϴϳϭ͘ϳϯ ϳϭϬϴϲϬ͘ϵ ϳϭϬϴϲϬ͘ϵ Ϭ ϭϮϯϱϱϲ Ϭ͘ϬϲϭϭϰϮ Ϭ Ϭ͘ϮϲϬϯϳϴ Ϭ͘ϬϬϭϭϰϱ Ϭ Ϭ͘ϬϬϭϴϴϵ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϭϵ Ϭ͘ϬϬϭϮϰϲ Ϭ Ϭ͘ϬϬϮϬϱϰ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϱϯ ϮϵϮ͘ϴϯϯϲ Ϭ ϳϰ͘ϵϯϭϰϲ Ϭ͘ϬϬϮϴϱϴ Ϭ Ϭ͘Ϭϲϲϭϵϵ Ϭ͘ϬϬϱϯϱϯ Ϭ Ϭ͘ϬϯϬϰϳ Ϭ͘ϬϭϮϬϳϯ Ϭ Ϭ͘ϯϮϬϯϬϮ Ϭ͘ϬϵϴϲϬϮ Ϭ͘Ϯϳϵϭϳϭ ϭ͘ϲϮϱϱϯϴ Ϭ͘Ϭϭϳϲϭϳ Ϭ Ϭ͘ϯϱϬϲϵϭ Ϭ͘ϬϵϴϲϬϮ Ϭ͘Ϯϳϵϭϳϭ ϭ͘ϲϮϱϱϯϴ Ϭ͘ϬϯϵϮϯϰ Ϭ͘ϳϳϳϭϴϴ Ϭ ϯ͘ϯϯϯϭϰϯ Ϭ͘ϬϬϮϴϵϱ Ϭ Ϭ͘ϬϬϬϳϰϭ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭ͘Ϯϳϵϵϵϭ ϭϳ͘Ϭϴϲϰϯ ϭϳ͘Ϭϴϲϰϯ Ϭ ϯ͘ϴϱϬϴϲϯ Ϭ͘ϵϮϲϳϳϯ Ϭ Ϭ Ϭ͘ϭϯϳϵϮϮ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϯϭϮϴ Ϭ͘ϭϰϰϭϱϵ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϵϯϴ ϯϳϰ͘ϵϬϯϮ Ϭ Ϭ Ϭ͘ϬϭϬϰϭϳ Ϭ Ϭ Ϭ͘ϬϱϵϬϲϲ Ϭ Ϭ Ϭ͘ϮϮϰϮϳϰϬϬϬϬϬϬ͘ϮϱϱϯϮϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ ϭ͘ϲϯϭϯϱϲ Ϭ Ϭ Ϭ͘ϬϬϯϱϱϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ Ϯϭϱ͘ϯϴϮ ϳϲϬϮ͘ϰϯ Ϭ ϳϲϬϮ͘ϰϯ ϭϬϲϰ͘ϯϭϱϬϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϯϬϬϬϬ͘ϬϬϴϬ͘ϬϬϰϯϳϮϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,Ǉďϭϲϴ͘ϳϳϭϳ ϱϳϯϴ͘ϲ Ϯϯϵϳ͘ϳϳϱ ϯϯϰϬ͘ϴϮϱ ϲϵϳ͘ϴϳϬϴ Ϭ͘ϬϬϮϲϴϰ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϮϳϰϬ Ϭ͘ϬϬϭϭϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϱϰ Ϭ͘ϬϬϬϮϵϴ Ϭ Ϭ͘ϬϬϭϮϭϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϲϵ ϭϭϮ͘ϳϳϯϴ Ϭ ϲϱ͘ϱϬϲϱϲ Ϭ͘ϬϬϬϯϯϲ Ϭ Ϭ͘ϬϰϬϵϮϲ Ϭ͘ϬϬϬϰϯϰ Ϭ Ϭ͘ϬϭϴϵϮϭ Ϭ͘ϬϬϭϭϮϴ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϮϵ Ϭ͘Ϭϭϵϳϭϱ Ϭ͘Ϯϲϰϴϲϵ Ϭ͘ϬϬϭϲϰϲ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϮϵ Ϭ͘Ϭϭϵϳϭϱ Ϭ͘Ϯϲϰϴϲϵ Ϭ͘Ϭϭϳϱϰϵ Ϭ͘ϭϲϴϰϴϯ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϭϱ Ϭ Ϭ͘ϬϬϬϲϰϴ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϴϴϳϵϭ͘ϰ ϱϰϱϰϬϳϲ ϱϰϱϰϬϳϲ Ϭ ϵϬϮϯϭϭ Ϭ͘Ϭϯϰϰϭϰ Ϭ Ϭ͘ϮϮϵϳϬϯ Ϭ͘ϬϬϬϵϯϴ Ϭ Ϭ͘ϬϬϭϱϴϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϰϵ Ϭ͘ϬϬϭϬϮϬ Ϭ͘ϬϬϭϳϮϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϱϲ Ϯϵϵ͘ϰϯϰϭ Ϭ ϳϱ͘ϰϭϮϴϮ Ϭ͘ϬϬϭϲϯϱ Ϭ Ϭ͘Ϭϱϲϴϭϳ Ϭ͘ϬϬϯϴϱϭ Ϭ Ϭ͘ϬϮϵϴϱϭ Ϭ͘ϬϬϱϴϴϲ Ϭ Ϭ͘ϮϱϭϬϴ Ϭ͘ϬϰϵϬϯϱ Ϭ͘ϭϯϬϵϯϰ Ϭ͘ϴϭϱϵϳϯ Ϭ͘ϬϬϴϱϴϴ Ϭ Ϭ͘ϮϳϰϵϬϭ Ϭ͘ϬϰϵϬϯϱ Ϭ͘ϭϯϬϵϯϰ Ϭ͘ϴϭϱϵϳϯ Ϭ͘ϬϰϬϯϲϳ Ϭ͘ϱϱϴϭϴϲ Ϭ Ϯ͘ϲϵϳϯϭϴ Ϭ͘ϬϬϮϵϲ Ϭ Ϭ͘ϬϬϬϳϰϲ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϳϮϭ͘ϰϰϯϱ ϮϬϲϮϬ͘ϱϭ ϮϬϲϮϬ͘ϱϭ Ϭ ϯϰϰϰ͘ϲϱϭ Ϭ͘ϬϯϬϰϬϰ Ϭ Ϭ Ϭ͘ϬϬϯϴϳϰ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϲϭ Ϭ͘ϬϬϰϬϱ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϴϵ Ϯϳϴ͘ϯϵϰϯ Ϭ Ϭ Ϭ͘ϬϬϬϱϰϯ Ϭ Ϭ Ϭ͘Ϭϰϯϴϲϭ Ϭ Ϭ Ϭ͘ϬϭϭϲϵϱϬϬϬϬϬϬ͘Ϭϭϯϯϭϰ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϭϱϰϲϮ Ϭ Ϭ Ϭ͘ϬϬϮϲϯϴ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯϭϰϴ͘ϭϰϴ ϴϬϭϬϰ͘Ϯϳ ϬϴϬϭϬϰ͘Ϯϳ ϭϱϳϵϲ͘ϱϳ Ϭ ϬϬϬϬϬϬ͘ϬϬϮϬ͘ϬϬϭϱϮϵ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ >dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϯϬϱϱ͘ϵϵϭ ϵϳϴϵϬ͘Ϯϵ ϰϮϱϬϬ͘Ϯϱ ϱϱϯϵϬ͘Ϭϰ ϭϮϲϯϲ͘ϱϮ Ϭ͘ϬϬϮϳϴϵ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϯϳ Ϭ Ϭ͘ϬϬϭϯϮϰ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϰϵ Ϭ͘ϬϬϬϯϲϳ Ϭ Ϭ͘ϬϬϭϰϯϵ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϱϰ ϭϭϳ͘ϭϳϭϮ Ϭϳϭ͘ϮϬϮϴϮ Ϭ͘ϬϬϬϯϰϴ Ϭ Ϭ͘ϬϰϬϴϭϲ Ϭ͘ϬϬϬϰϰϴ Ϭ Ϭ͘ϬϭϴϴϮ Ϭ͘ϬϬϭϭϳϮ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϱϬϴϳ Ϭ͘ϬϮϮϱϯϭ Ϭ͘Ϯϴϱϭϴϭ Ϭ͘ϬϬϭϳϭϭ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϱϬϴϳ Ϭ͘ϬϮϮϱϯϭ Ϭ͘Ϯϴϱϭϴϭ Ϭ͘ϬϭϴϮϮϵ Ϭ͘ϭϳϱϬϭϴ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϱϴ Ϭ Ϭ͘ϬϬϬϳϬϰ^ĂŶDĂƚĞŽ ϮϬϮϴ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϮϴϵϰ͘ϱϰ ϰϬϵϰϲϴ͘ϭ ϰϬϵϰϲϴ͘ϭ Ϭ ϭϵϮϭϬϵ͘ϰ Ϭ͘ϬϲϰϭϬϴ Ϭ͘ϬϮϵϴϲϲ Ϭ͘ϰϴϴϳϰϰ Ϭ͘ϬϬϭϮϵ Ϭ Ϭ͘ϬϬϬϭϳϰ Ϭ͘ϬϬϮ Ϭ͘ϬϮϳϯ Ϭ͘ϬϬϭϰϬϯ Ϭ Ϭ͘ϬϬϬϭϴϵ Ϭ͘ϬϬϴ Ϭ͘Ϭϳϴ ϳϵϰ͘ϴϬϳϯ ϭϭϮ͘ϲϲϰϱ Ϯϱ͘ϴϱϬϱϱ Ϭ͘ϬϬϯϰϭϵ Ϭ͘Ϭϵϲϭϴϴ Ϭ͘ϬϮϰϭϰϭ Ϭ͘ϬϬϯϴϬϱ Ϭ͘ϬϬϮϲϲϯ Ϭ͘ϬϰϮϱϯϵ Ϭ͘Ϭϭϱϵ Ϭ͘ϯϰϮϱϵϳ Ϭ͘ϭϭϱϯϵϲ Ϭ͘ϬϮϲϭϬϲ Ϭ͘ϭϰϴϳϲϯ ϭ͘ϱϬϯϳϲϰ Ϭ͘ϬϮϯϮϬϭ Ϭ͘ϰϵϵϵϭϳ Ϭ͘ϭϮϲϯϰϰ Ϭ͘ϬϮϲϭϬϲ Ϭ͘ϭϰϴϳϲϯ ϭ͘ϱϬϯϳϲϰ Ϭ͘Ϭϰϱ Ϭ͘ϳϳϳϲϳϯ ϯ͘ϳϳϬϱϴϰ ϯ͘ϯϵϭϲϳϴ Ϭ͘ϬϬϳϴϱϳ Ϭ͘ϬϬϭϭϭϰ Ϭ͘ϬϬϬϮϱϲ^ĂŶDĂƚĞŽ ϮϬϮϴ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϲϰϯϰ͘ϰϳϵ ϮϭϱϴϰϮ͘ϭ ϮϭϱϴϰϮ͘ϭ Ϭ ϴϬϵϯϳ͘ϲϱ Ϭ͘ϱϵϯϯϮϰ ϭ͘ϮϴϯϮϱϰ Ϭ Ϭ͘Ϭϭϴϴϯϱ Ϭ͘ϬϮϲϰϳϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϮϳϯ Ϭ͘Ϭϭϵϲϴϳ Ϭ͘ϬϮϳϲϳϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϳϴ ϲϭϯ͘ϱϳϰϯ ϭϮϭ͘ϭϬϴϳ Ϭ Ϭ͘ϬϬϰϵϬϯ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϬϵϲϲϲϵϬ͘ϬϭϵϬϴϭ Ϭ Ϭ͘ϭϬϱϱϱϭ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϮϬϭϲϮ Ϭ͘ϭϮϰϵϱϰϬϬϬϬϬ͘ϮϬϱϲϲϵ Ϭ͘Ϯϰϵϭϴ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϱϴϭϰ Ϭ͘ϬϬϭϭϰϴ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ >,dϭ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϴϭϱ͘ϵϮϯϯ ϯϴϭϯϲ͘ϴϮϬ ϯϴϭϯϲ͘ϴϮ ϭϭϰϮϱ͘Ϭϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘Ϭϭϯϲϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϯϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϰϲϲ͘ϱϯϭ ϰϱϬϵϯ͘ϱϯ ϰϱϬϵϯ͘ϱϯ Ϭ Ϯϭϴϰϵ͘ϭϮ Ϭ͘Ϭϲϳϵϲϴ Ϭ͘ϬϮϴϬϳϮ Ϭ͘ϰϳϴϳϲϯ Ϭ͘ϬϬϭϮϭϮ Ϭ Ϭ͘ϬϬϬϭϰϱ Ϭ͘ϬϬϮ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϬϭϯϭϴ Ϭ Ϭ͘ϬϬϬϭϱϳ Ϭ͘ϬϬϴ Ϭ͘Ϭϵϭ ϴϵϲ͘ϴϲϳϭ ϭϯϬ͘ϯϳϬϰ Ϯϰ͘ϰϯϵϯϱ Ϭ͘ϬϬϮϲϯϰϬ͘ϬϵϬϭϭϯ Ϭ͘ϬϮϮϴϵϰ Ϭ͘ϬϬϰϰϲϯ Ϭ͘ϬϬϮϰϰϲ Ϭ͘ϬϰϬϮϲϳ Ϭ͘ϬϭϭϮϰϲ Ϭ͘ϯϮϮϭϲϳ Ϭ͘ϭϬϵϬϱϵ Ϭ͘ϬϮϲϲϱϰ Ϭ͘ϭϱϮϲϬϳ ϭ͘ϲϬϴϱϬϰ Ϭ͘ϬϭϲϰϬϵ Ϭ͘ϰϳϬϭϬϲ Ϭ͘ϭϭϵϰϬϲ Ϭ͘ϬϮϲϲϱϰ Ϭ͘ϭϱϮϲϬϳ ϭ͘ϲϬϴϱϬϰ Ϭ͘Ϭϰϱ Ϭ͘ϲϲϰϳϯϵ ϯ͘ϳϳϰϳϬϰ ϯ͘ϯϭϲϱϮϭ Ϭ͘ϬϬϴϴϲϲ Ϭ͘ϬϬϭϮϴϵ Ϭ͘ϬϬϬϮϰϮ^ĂŶDĂƚĞŽ ϮϬϮϴ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů Ϯϵϰϲ͘ϯϰϴ ϵϲϵϱϬ͘ϴ ϵϲϵϱϬ͘ϴ Ϭ ϯϳϬϲϭ͘ϯϱ Ϭ͘ϰϵϲϴϰϭ ϭ͘ϮϰϯϱϬϲ Ϭ Ϭ͘Ϭϭϴϵϲϰ Ϭ͘ϬϮϲϳϲϳ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘ϬϭϵϴϮϭ Ϭ͘ϬϮϳϵϳϳ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϵϭ ϳϭϴ͘ϵϵϵϵ ϭϵϯ͘ϴϰϳϱ Ϭ Ϭ͘ϬϬϱϬϮ Ϭ͘ϬϬϱϬϵϴ Ϭ Ϭ͘ϭϭϯϮϳϵ Ϭ͘ϬϯϬϱϰϭ Ϭ Ϭ͘ϭϬϴϬϴϯ Ϭ͘ϭϬϵϳϲϬϬϬϬϬ͘ϭϮϯϬϰϱ Ϭ͘ϭϮϰϵϱϰ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϵϵϱϵ Ϭ͘Ϯϰϭϵ Ϭ͘ϵϬϵϳϰϱ Ϭ Ϭ͘ϬϬϲϴϭϯ Ϭ͘ϬϬϭϴϯϳ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ >,dϮ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϮϬϲ͘ϴϰϳϲ ϵϮϯϯ͘ϭϬϰϬ ϵϮϯϯ͘ϭϬϰ Ϯϳϰϯ͘ϲϰϱ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϰϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ Dz ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϲϬϮϰ͘ϴϰ ϴϯϭϵϭ͘Ϭϲ ϴϯϭϵϭ͘Ϭϲ Ϭ ϯϮϬϰϵ͘ϲϴ Ϭ͘ϰϴϬϳϳϰ Ϭ Ϭ͘Ϭϵϳϳϭϳ Ϭ͘ϬϬϭϵϮϯ Ϭ Ϭ͘ϬϬϯϰϰϳ Ϭ͘ϬϬϭ Ϭ͘ϬϬϰϮ Ϭ͘ϬϬϮϬϲ Ϭ Ϭ͘ϬϬϯϲϴϯ Ϭ͘ϬϬϰ Ϭ͘ϬϭϮ ϭϴϱ͘ϱϱϳϴ Ϭ ϰϭ͘ϮϴϮϳ Ϭ͘ϭϯϮϲϳϱ Ϭ Ϭ͘ϭϱϭϭϬϳ Ϭ͘Ϭϯϱϰϰϲ Ϭ Ϭ͘ϬϬϲϬϴϰ Ϭ͘ϴϭϴϳϳϭ Ϭ ϭ͘Ϭϴϳϯϵ ϯ͘ϱϰϭϬϮϭ ϯ͘ϲϴϳϱϲϱ Ϯ͘ϴϴϰϭϬϯ ϭ͘ϬϬϲϴϲϳ Ϭ ϭ͘ϭϴϯϬϰϯ ϯ͘ϱϰϭϬϮϭ ϯ͘ϲϴϳϱϲϱ Ϯ͘ϴϴϰϭϬϯ Ϭ͘ϬϬϵϬϰ ϵ͘ϵϳϭϯϮϲ Ϭ ϳ͘ϲϬϭϱϯϲ Ϭ͘ϬϬϭϴϯϰ Ϭ Ϭ͘ϬϬϬϰϬϴ^ĂŶDĂƚĞŽ ϮϬϮϴ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϭϬϲϬϰϲ͘ϴ ϯϭϯϵϮϮϵ ϯϭϯϵϮϮϵ Ϭ ϱϬϱϲϭϲ͘ϲ Ϭ͘ϬϯϳϬϴϰ Ϭ Ϭ͘ϮϱϮϳϱϯ Ϭ͘ϬϬϬϵϮϮ Ϭ Ϭ͘ϬϬϭϱϵϯ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϳϳϭ Ϭ͘ϬϬϭϬϬϯ Ϭ Ϭ͘ϬϬϭϳϯϮ Ϭ͘ϬϬϴ Ϭ͘ϬϬϳϵϭϴ ϯϲϭ͘Ϯϭϲϯ Ϭ ϵϭ͘ϯϳϯϳϳ Ϭ͘ϬϬϭϳϮ Ϭ Ϭ͘ϬϲϭϯϭϮ Ϭ͘ϬϬϰϬϬϱ Ϭ Ϭ͘ϬϯϬϵϲ Ϭ͘ϬϬϲϯϱϯ Ϭ Ϭ͘Ϯϴϭϳϴϯ Ϭ͘ϬϱϮϲϯϮ Ϭ͘ϭϰϱϱϬϱ Ϭ͘ϵϬϭϳϵϴ Ϭ͘ϬϬϵϮϳ Ϭ Ϭ͘ϯϬϴϱϭϳ Ϭ͘ϬϱϮϲϯϮ Ϭ͘ϭϰϱϱϬϱ Ϭ͘ϵϬϭϳϵϴ Ϭ͘ϬϰϬϰϮϭ Ϭ͘ϱϲϲϲϳϳ Ϭ Ϯ͘ϳϳϲϲϲϮ Ϭ͘ϬϬϯϱϳϭ Ϭ Ϭ͘ϬϬϬϵϬϯ^ĂŶDĂƚĞŽ ϮϬϮϴ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϯϰϰ͘ϲϮϰ ϯϴϭϯϴ͘ϳ ϯϴϭϯϴ͘ϳ ϬϲϯϱϬ͘ϳϴ Ϭ͘ϬϮϮϭϮϲ Ϭ Ϭ Ϭ͘ϬϬϮϱϱϯ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϴϮϴ Ϭ͘ϬϬϮϲϲϵ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴϬϴ ϯϲϳ͘ϳϮϲϯ Ϭ Ϭ Ϭ͘ϬϬϬϯϭϲ Ϭ Ϭ Ϭ͘Ϭϱϳϵϯϱ Ϭ Ϭ Ϭ͘ϬϬϲϴϭϯϬϬϬϬϬϬ͘ϬϬϳϳϱϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯϭ Ϭ͘ϭϱϰϭϵϱ Ϭ Ϭ Ϭ͘ϬϬϯϰϴϰ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϯϮϳϯ͘ϱϬϳ ϴϯϬϱϳ͘ϲϱ Ϭ ϴϯϬϱϳ͘ϲϱ ϭϲϰϭϭ͘ϯϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϯ Ϭ Ϭ Ϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϰϯϳϭϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ Ds ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ WůƵŐͲŝŶ,ǇďϭϴϭϮ͘ϰϬϯ ϲϬϭϰϳ͘ϱϳ ϮϲϬϬϬ͘ϰ ϯϰϭϰϳ͘ϭϲ ϳϰϵϰ͘Ϯϴϴ Ϭ͘ϬϬϮϳϳϳ Ϭ Ϭ͘ϭϭϳϭϵϵ Ϭ͘ϬϬϬϯϱϬ Ϭ͘ϬϬϭϯϴϴ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϯϱ Ϭ͘ϬϬϬϯϴϭ Ϭ Ϭ͘ϬϬϭϱϭ Ϭ͘ϬϬϴ Ϭ͘ϬϬϯϴϱϴ ϭϭϲ͘ϲϲϰ Ϭ ϴϲ͘ϱϱϵϳϵ Ϭ͘ϬϬϬϯϰϴ Ϭ Ϭ͘ϬϰϬϵϳϲ Ϭ͘ϬϬϬϰϱ Ϭ Ϭ͘Ϭϭϴϵϲϴ Ϭ͘ϬϬϭϭϲϳ Ϭ Ϭ͘ϭϳϲϲϯϱ Ϭ͘ϬϮϳϰϭϱ Ϭ͘ϬϮϲϱϭ Ϭ͘ϯϭϲϰϰϵ Ϭ͘ϬϬϭϳϬϯ Ϭ Ϭ͘ϭϵϯϯϵϯ Ϭ͘ϬϮϳϰϭϱ Ϭ͘ϬϮϲϱϭ Ϭ͘ϯϭϲϰϰϵ Ϭ͘Ϭϭϴϭϱϲ Ϭ͘ϭϳϰϮϲϲ Ϭ ϭ͘ϯϳϴϭϵ Ϭ͘ϬϬϭϭϱϯ Ϭ Ϭ͘ϬϬϬϴϱϲ^ĂŶDĂƚĞŽ ϮϬϮϴ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϵϭϴ͘ϭϯϮϴ ϴϲϰϬ͘ϵϭϳ ϴϲϰϬ͘ϵϭϳ Ϭ ϵϭ͘ϴϱϬϬϭ Ϭ͘ϭϴϮϴϱϯ Ϭ Ϭ͘ϯϵϭϴϴϳ Ϭ͘ϬϬϭϰϰϲ Ϭ Ϭ͘ϬϬϬϯϲϱ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϱϳϯ Ϭ Ϭ͘ϬϬϬϯϵϳ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϵϰϱ͘ϯϵϰ Ϭ ϯϬ͘ϳϲϭϯϴ Ϭ͘ϬϬϲϳϵϳ Ϭ Ϭ͘Ϭϯϯϴϳϱ Ϭ͘Ϭϭϱϰϵϳ Ϭ Ϭ͘ϬϰϰϳϬϵ Ϭ͘ϬϮϰϳϯϱ Ϭ Ϭ͘ϭϯϮϰϮϲ ϱ͘ϲϵϯϭϱϴ Ϭ͘ϭϯϳϵϭϭ Ϯ͘ϭϰϭϴϰϰ Ϭ͘ϬϯϲϬϵϯ ϬϬ͘ϭϰϰϵϵ ϱ͘ϲϵϯϭϱϴ Ϭ͘ϭϯϳϵϭϭ Ϯ͘ϭϰϭϴϰϰ Ϭ͘Ϭϰϱ Ϭ͘ϰϳϯϮϴϲ Ϭ Ϯ͘ϵϵϯϯϲϲ Ϭ͘ϬϭϵϮϯϮ Ϭ Ϭ͘ϬϬϬϯϬϰ^ĂŶDĂƚĞŽ ϮϬϮϴ D, ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϲϱ͘ϲϱϯϱ ϰϮϳϳ͘ϵϲϯ ϰϮϳϳ͘ϵϲϯϬ ϰϲ͘ϱϲϱϯϱ Ϯ͘ϳϳϯϮϳϱ Ϭ Ϭ Ϭ͘Ϭϯϰϳϯϴ Ϭ Ϭ Ϭ͘ϬϬϰ Ϭ͘Ϭϭϱϲϳϱ Ϭ͘ϬϯϲϯϬϴ Ϭ Ϭ Ϭ͘Ϭϭϲ Ϭ͘Ϭϰϰϳϴϱ ϭϬϴϲ͘ϵϮ Ϭ Ϭ Ϭ͘ϬϬϯϴϳϵ Ϭ Ϭ Ϭ͘ϭϳϭϮϰϱ Ϭ Ϭ Ϭ͘ϬϴϯϱϬϰϬϬϬϬϬϬ͘ϬϵϱϬϲϯ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϬϮϴϵϯ Ϭ͘ϮϱϮϴϮϰ Ϭ Ϭ Ϭ͘ϬϭϬϮϵϵ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϴϮ͘Ϯϴϳϵ ϰϴϮϬϴ͘Ϯϵ ϰϴϮϬϴ͘Ϯϵ Ϭ ϭϳϲϱϮ͘ϴϮ Ϭ͘ϭϵϮϳϯϳ Ϭ͘ϬϳϱϵϮϳ Ϭ͘ϯϲϱϱϮϲ Ϭ͘ϬϬϭϯϰϲ Ϭ Ϭ͘ϬϬϬϰϳϳ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϳϱϲ Ϭ͘ϬϬϭϰϲϰ Ϭ Ϭ͘ϬϬϬϱϭϵ Ϭ͘ϬϭϮ Ϭ͘ϬϰϱϬϭϳ ϭϲϲϱ͘ϴϭϰ ϱϬϯ͘ϮϮϰ ϰϭ͘ϵϳϴϭϭ Ϭ͘ϬϬϲϰϴ Ϭ͘ϮϳϮϬϳϰ Ϭ͘ϬϰϬϵϲϱ Ϭ͘ϬϭϮϭϬϱ Ϭ͘ϬϬϲϴϲϲ Ϭ͘Ϭϯϭϰϴϵ Ϭ͘ϬϮϵϰϱϯ ϭ͘ϬϮϮϲϮ Ϭ͘ϮϭϭϲϮϴ Ϭ͘ϬϮϬϭϯϴ Ϭ͘ϭϲϵϮϭϵ ϭ͘ϲϰϳϳϱϮ Ϭ͘ϬϰϮϵϳϴ ϭ͘ϰϵϮϮϬϰ Ϭ͘ϮϯϭϳϬϲ Ϭ͘ϬϮϬϭϯϴ Ϭ͘ϭϲϵϮϭϵ ϭ͘ϲϰϳϳϱϮ Ϭ͘Ϭϰϱ Ϭ͘ϱϲϬϱϱϰ ϭϱ͘Ϯϯϭϱϭ ϰ͘ϱϰϴϭϮϮ Ϭ͘Ϭϭϲϰϲϴ Ϭ͘ϬϬϰϵϳϱ Ϭ͘ϬϬϬϰϭϱ^ĂŶDĂƚĞŽ ϮϬϮϴ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϰϯϵϲ͘Ϯϰϱ ϭϳϲϭϯϲ͘ϲ ϭϳϲϭϯϲ͘ϲ Ϭ ϱϯϭϲϴ͘ϭϮ Ϭ͘ϴϵϰϵϬϱ ϭϭ͘ϬϬϳϱϭ ϭ͘ϱϴϰϯϭ Ϭ͘ϬϬϴϵϳϲ Ϭ͘Ϭϭϱϯϱϰ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϵϴϯ Ϭ͘ϬϬϵϯϴϮ Ϭ͘ϬϭϲϬϰϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϲϲϱ ϭϭϮϱ͘ϯϰϲ Ϯϭϳϭ͘Ϯϭϳ Ϭ Ϭ͘ϬϬϬϵϲϴ Ϭ͘ϬϬϵϳϴϳ Ϭ Ϭ͘ϭϳϳϮϵϵ Ϭ͘ϯϰϮϬϳϲ Ϭ Ϭ͘ϬϮϬϴϯϭ Ϭ͘ϮϭϬϳϮϭϬϬϬϬϬ͘ϬϮϯϳϭϱ Ϭ͘Ϯϯϵϴϴϵ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϭϰϭϬϰ Ϭ͘Ϭϴϵϵϭ ϳ͘ϰϴϳϭϵϮ Ϭ Ϭ͘ϬϭϬϲϱϲ Ϭ͘ϬϮϬϱϲ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϮϬϱ͘ϲϯϵϱ ϭϭϭϲϵ͘Ϭϯ Ϭϭϭϭϲϵ͘Ϭϯ Ϯϴϯϵ͘ϴϮϳ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϬϳϵϱϮ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϳϭϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ D,d ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϱϰ͘ϳϬϭϲϴ Ϯϯϵϰ͘ϰϭϴ Ϯϯϵϰ͘ϰϭϴ Ϭ ϱϭϰ͘ϮϮϮϴ Ϭ͘ϭϬϯϬϴϱ ϲ͘ϯϴϳϰϯϰ Ϭ Ϭ͘ϬϬϭϯϳϮ Ϭ͘ϬϮϬϬϮϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϲϬϴϰ Ϭ͘ϬϬϭϰϵϮ Ϭ͘ϬϮϭϳϴϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϵϱϱ ϵϴϭ͘ϲϴϯϴ ϱϯϱϯ͘ϳϬϯ Ϭ Ϭ͘ϳϴϬϴϵϯ ϭϲ͘ϮϭϭϬϮ ϬϬ͘ϮϬϬϭϮϯ ϭ͘Ϭϵϭϯϴϳ Ϭ Ϭ͘Ϭϭϭϭϱϳ Ϭ͘ϮϯϭϲϮϰϬϬϬϬϬ͘ϳϵϲϵϱϴ ϭϲ͘ϱϰϰϱϰ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘Ϭϱϵϭϰϱ ϯϵ͘ϬϰϴϮϲϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ Ϯϰϰ͘ϯϱϴϲ ϭϭϴϱϮ͘ϰ ϭϭϴϱϮ͘ϰ Ϭ ϰϴϴϵ͘ϭϮϳ Ϭ͘ϭϴϵϮϱϲ Ϭ͘ϬϱϴϰϵϮ Ϭ͘ϯϰϴϱϮϮ Ϭ͘ϬϬϭϭϬϮ Ϭ Ϭ͘ϬϬϬϮϴϲ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϱϲϴ Ϭ͘ϬϬϭϭϵϴ Ϭ Ϭ͘ϬϬϬϯϭϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϳϵϵ ϭϲϱϲ͘ϲϵ ϯϲϬ͘ϰϳϲϵ Ϯϴ͘ϵϰϳϲϰ Ϭ͘ϬϬϱϲϳϭ Ϭ͘ϮϬϯϱϱϵ Ϭ͘Ϭϯϭϰϴϯ Ϭ͘ϬϭϮϬϭϵ Ϭ͘ϬϬϱϮϰϳ Ϭ͘ϬϮϵϳϴϵ Ϭ͘ϬϮϰϵϵϴ Ϭ͘ϳϰϴϯϮϵ Ϭ͘ϭϱϲϵϰϰϬ͘ϬϮϱϭϲϳ Ϭ͘ϭϮϲϮϭϳ Ϯ͘ϭϳϳϰϮϯ Ϭ͘Ϭϯϲϰϳϳ ϭ͘Ϭϵϭϵϱϵ Ϭ͘ϭϳϭϴϯϰ Ϭ͘ϬϮϱϭϲϳ Ϭ͘ϭϮϲϮϭϳ Ϯ͘ϭϳϳϰϮϯ Ϭ͘Ϭϰϱ Ϭ͘ϱϮϬϭϵϱ ϱ͘ϳϴϲϵϳϵ ϯ͘ϭϵϰϳϬϲ Ϭ͘Ϭϭϲϯϳϴ Ϭ͘ϬϬϯϱϲϰ Ϭ͘ϬϬϬϮϴϲ^ĂŶDĂƚĞŽ ϮϬϮϴ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϮϭϭ͘ϯϵϯ ϳϲϭϵϵ͘ϰϴ ϳϲϭϵϵ͘ϰϴ Ϭ ϭϭϴϵϰ͘ϳϴ Ϭ͘ϳϱϵϭϳϮ ϱ͘Ϭϱϭϲϯϯ ϭ͘ϰϮϱϲϭϰ Ϭ͘ϬϬϴϲϵϯ Ϭ͘ϬϬϮϴϵϱ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϳϰϲϲ Ϭ͘ϬϬϵϬϴϲ Ϭ͘ϬϬϯϬϮϲ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϰϵϵϬϮ ϭϭϴϱ͘ϭϯϰ ϭϭϴϰ͘Ϭϭϱ Ϭ Ϭ͘ϬϬϬϴϲϭ Ϭ͘Ϭϭϰϰϭϯ Ϭ Ϭ͘ϭϴϲϳϭϴ Ϭ͘ϭϴϲϱϰϮ Ϭ Ϭ͘ϬϭϴϱϮϵ Ϭ͘ϯϭϬϯϭϲϬϬϬϬϬ͘ϬϮϭϬϵϰ Ϭ͘ϯϱϯϮϳϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϭϴϬϵ Ϭ͘Ϭϴϵϯϳϳ ϱ͘ϳϴϲϵϯϵ Ϭ Ϭ͘ϬϭϭϮϮϯ Ϭ͘ϬϭϭϮϭϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϴ͘ϵϯϱϴϯϭ ϲϵϭ͘ϯϲϱϴ Ϭϲϵϭ͘ϯϲϱϴ ϭϳϴ͘ϳϴϴϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϬϳϴϰ Ϭ Ϭ Ϭ Ϭ͘ϬϭϮ Ϭ͘ϬϮϮϯϵϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ Kh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϭϮ͘ϳϮϳϯϴ ϴϮϭ͘ϰϴϮϮ ϴϮϭ͘ϰϴϮϮ Ϭ ϭϭϯ͘Ϯϳϯϳ Ϭ͘ϭϭϳϵϭϲ ϭ͘ϱϬϳϱϴϮ Ϭ Ϭ͘ϬϬϭϰϬϱ Ϭ͘ϬϬϰϲϭϭ Ϭ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϲϭϰϴ Ϭ͘ϬϬϭϱϮϵ Ϭ͘ϬϬϱϬϭϱ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϲϭϯϳ ϵϱϬ͘ϳϰϱϭ ϭϭϴϬ͘ϰϳϮ Ϭ Ϭ͘ϴϮϵϰϰϱ ϯ͘ϴϲϴϱϲϵ ϬϬ͘ϭϵϯϴϭϲ Ϭ͘ϮϰϬϲϰϳ Ϭ Ϭ͘Ϭϭϭϴϱϭ Ϭ͘ϬϱϱϮϳϰϬϬϬϬϬ͘ϴϰϲϱϬϵ ϯ͘ϵϰϴϭϱϴ Ϭ Ϭ Ϭ Ϭ ϭ͘Ϭϲ ϯ͘ϯϲϭϭϰϰ ϴ͘ϵϱϳϰϯϰϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϴϮ͘ϳϲϰϬϱ ϯϵϱϬ͘ϳϵϳ ϯϵϱϬ͘ϳϵϳ Ϭ ϯϯϭ͘ϬϱϲϮ Ϭ͘ϱϳϯϭϵϳ Ϭ͘ϳϵϮϴϮϳ Ϭ͘ϱϴϮϳϵϲ Ϭ͘ϬϬϭϬϱϴ Ϭ Ϭ͘ϬϬϬϳϭϵ Ϭ͘ϬϬϮ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϭϭϱϭ Ϭ Ϭ͘ϬϬϬϳϴϮ Ϭ͘ϬϬϴ Ϭ͘Ϭϰϰϵϭϳ ϳϲϰ͘ϵϳϵϭ Ϯϰϱϭ͘ϵϱϱ ϱϲ͘ϲϭϱϱϵ Ϭ͘ϬϭϮϱϱϰ Ϯ͘ϰϰϴϯϰϲ Ϭ͘Ϭϳϴϰϯϳ Ϭ͘ϬϮϴϯϱϱ Ϭ͘Ϭϳϲϲϰϭ Ϭ͘Ϭϱϰϯϭϱ Ϭ͘Ϭϲϭϯϱϭ ϭϬ͘ϲϰϭϱϮ Ϭ͘ϰϱϮϱϭϴ Ϭ͘ϭϬϰϯϭϳ Ϭ͘ϯϯϮϬϴϰ ϭ͘ϴϯϳϭϬϰ Ϭ͘ϬϴϵϱϮϯ ϭϱ͘ϱϮϴϬϴ Ϭ͘ϰϵϱϰϱϭ Ϭ͘ϭϬϰϯϭϳ Ϭ͘ϯϯϮϬϴϰ ϭ͘ϴϯϳϭϬϰ Ϭ͘Ϭϰϱ ϭ͘ϱϵϯϵϲϱ ϴϮ͘ϮϰϬϴϴ ϭϬ͘ϳϵϱϴϴ Ϭ͘ϬϬϳϱϲϯ Ϭ͘ϬϮϰϮϰ Ϭ͘ϬϬϬϱϲ^ĂŶDĂƚĞŽ ϮϬϮϴ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϭϲϲ͘Ϭϭϲϴ ϯϲϲϮ͘ϲϵϵ ϯϲϲϮ͘ϲϵϵ Ϭ ϮϰϬϯ͘ϵϮϯ ϯ͘ϰϴϲϭϳϱ ϭϵ͘ϲϮϮϯϴ Ϭ͘ϱϮϰϯϰϭ Ϭ͘Ϭϭϳϭϱϱ Ϭ͘Ϭϭϲϭϭϵ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘Ϭϭϳϵϯ Ϭ͘Ϭϭϲϴϰϴ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϭϮϯ͘ϰϮϳ Ϯϭϴϴ͘ϯϬϴ Ϭ Ϭ͘ϬϬϮϱϴϵ Ϭ͘ϬϬϳϵϳϯ Ϭ Ϭ͘ϭϳϲϵϵϲ Ϭ͘ϯϰϰϳϲϵ Ϭ Ϭ͘Ϭϱϱϳϰϵ Ϭ͘ϭϳϭϲϱϬϬϬϬϬ͘Ϭϲϯϰϲϲ Ϭ͘ϭϵϱϰϭϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϭϱϵϰϰϰ Ϭ͘ϭϳϰϵϯϲ ϰ͘ϵϳϴϵϴϲ Ϭ Ϭ͘ϬϭϬϲϯϴ Ϭ͘ϬϮϬϳϮϮ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϴ͘ϰϭϬϴϭϮ ϯϭϱ͘ϵϭϲϰ Ϭϯϭϱ͘ϵϭϲϰ ϳϲ͘ϭϲϯϱϮϬϬϬϬϬϬϬ͘ϬϬϮϯϰϮ Ϭ͘ϬϬϳϴϲ Ϭ Ϭ Ϭ Ϭ͘ϬϬϵϯϲϵ Ϭ͘ϬϮϮϰϱϵϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ ^h^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϳ͘Ϯϴϯϯϱϯ ϭϳϲ͘ϭϮϵϴ ϭϳϲ͘ϭϮϵϴ Ϭ ϭϬϱ͘ϰϲϯ Ϭ͘ϰϲϳϯϲϳ ϱ͘Ϯϭϭϰϲϯ Ϭ Ϭ͘ϬϬϯϯϳϴ Ϭ͘ϬϭϮϳϳϱ Ϭ Ϭ͘ϬϬϯ Ϭ͘ϬϭϱϳϮϭ Ϭ͘ϬϬϯϲϳϰ Ϭ͘Ϭϭϯϴϵϰ Ϭ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϰϵϭϳ ϭϮϭϯ͘Ϭϯϯ ϰϭϭϰ͘Ϯϱϲ Ϭ ϯ͘ϭϲϯϭϮϱ ϭϰ͘ϱϮϮϴϲ Ϭ Ϭ͘ϮϰϳϮϴϱ Ϭ͘ϴϯϴϳϭϴ Ϭ Ϭ͘Ϭϰϱϭϵϱ Ϭ͘ϮϬϳϱϬϯ Ϭ Ϭ Ϭ Ϭ ϯ͘ϮϮϴϮϬϭ ϭϰ͘ϴϮϭϲϰ Ϭ Ϭ Ϭ Ϭϭ͘Ϭϲ ϭϬ͘ϯϲϭϳϮ Ϯϯ͘ϵϰϯϮϯϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ 'ĂƐŽůŝŶĞ ϲϮ͘ϭϲϯϲϵ ϰϮϮϲ͘ϰϱ ϰϮϮϲ͘ϰϱ Ϭ Ϯϰϴ͘ϲϱϰϴ Ϭ͘Ϭϯϯϴϳϯ Ϭ Ϭ͘ϯϯϬϳ Ϭ͘ϬϬϭϮϬϮ Ϭ Ϭ͘ϬϬϬϭϲϰ Ϭ͘ϬϬϮϬϳϮ Ϭ͘ϬϯϮϯϯϭ Ϭ͘ϬϬϭϯϬϳ Ϭ Ϭ͘ϬϬϬϭϳϵ Ϭ͘ϬϬϴϮϵ Ϭ͘ϬϵϮϯϳϱ ϵϯϮ͘ϲϯϰϳ Ϭ ϯϴ͘ϭϴϲϮ Ϭ͘ϬϬϭϱϵϴ Ϭ Ϭ͘ϬϯϮϲϯϴ Ϭ͘ϬϬϰϯϵϴ Ϭ Ϭ͘Ϭϱϭϲϰϵ Ϭ͘ϬϬϰϰϯϮ Ϭ Ϭ͘ϭϭϲϳϭϱ Ϭ͘ϬϮϯϵϯϰ Ϭ͘ϬϵϬϱϰϰ Ϭ͘ϯϭϲϵϭϯ Ϭ͘ϬϬϲϰϲϲ Ϭ Ϭ͘ϭϮϳϳϴϴ Ϭ͘ϬϮϯϵϯϰ Ϭ͘ϬϵϬϱϰϰ Ϭ͘ϯϭϲϵϭϯ Ϭ͘Ϭϰϱ Ϭ͘ϱϱϴϳϱϭ Ϭ ϲ͘ϯϱϵϭϱϱ Ϭ͘ϬϬϵϮϮϬ Ϭ͘ϬϬϬϯϳϴ^ĂŶDĂƚĞŽ ϮϬϮϴ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ŝĞƐĞů ϮϲϬ͘ϳϵϵϮ ϭϵϵϬϮ͘ϳϵ ϭϵϵϬϮ͘ϳϵ Ϭ ϭϬϰϯ͘ϭϵϳ Ϭ͘ϯϳϰϵϱϯ Ϭ Ϭ Ϭ͘ϬϬϲϴϭϲ Ϭ Ϭ Ϭ͘ϬϬϴϬϴϱ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϳϭϮϰ Ϭ Ϭ Ϭ͘ϬϯϮϯϰϮϬ͘ϭϭ ϭϮϰϱ͘ϰϴ Ϭ Ϭ Ϭ͘ϬϬϯϭϰϭ Ϭ Ϭ Ϭ͘ϭϵϲϮϮϲ Ϭ Ϭ Ϭ͘ϬϲϳϲϯϰϬϬϬϬϬϬ͘Ϭϳϲϵϵϲ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϮϮ Ϭ͘ϬϳϳϬϳϭ Ϭ Ϭ Ϭ͘ϬϭϭϴϬϮ Ϭ Ϭ^ĂŶDĂƚĞŽ ϮϬϮϴ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ ůĞĐƚƌŝĐŝƚǇ ϱϯ͘ϯϭϴϴϭ ϱϯϮϲ͘ϲϵϲ ϬϱϯϮϲ͘ϲϵϲ Ϯϭϯ͘ϮϳϱϮϬϬϬϬϬϬϬ͘ϬϬϳϱϵϰ Ϭ͘ϬϭϵϮϱ Ϭ Ϭ Ϭ Ϭ͘ϬϯϬϯϳϳ Ϭ͘ϬϱϱϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬϬ^ĂŶDĂƚĞŽ ϮϬϮϴ hh^ ŐŐƌĞŐĂƚĞ ŐŐƌĞŐĂƚĞ EĂƚƵƌĂů'Ă ϳϬ͘ϯϬϰϮϲ ϰϵϲϳ͘ϰϲϵ ϰϵϲϳ͘ϰϲϵ Ϭ Ϯϴϭ͘Ϯϭϳ Ϭ͘ϬϱϱϳϯϮ Ϭ Ϭ Ϭ͘ϬϬϬϮϳϯ Ϭ Ϭ Ϭ͘ϬϬϳϳϴϭ Ϭ͘Ϭϯϴϱ Ϭ͘ϬϬϬϮϴϲ Ϭ Ϭ Ϭ͘ϬϯϭϭϮϱ Ϭ͘ϭϭ ϭϮϲϱ͘ϵϵϴ Ϭ Ϭ ϰ͘ϭϭϯϴϯϳ Ϭ Ϭ Ϭ͘ϮϱϴϬϴϮ Ϭ Ϭ Ϭ͘ϬϱϴϳϳϵϬϬϬϬϬϰ͘ϭϵϴϰϳϮ Ϭ Ϭ Ϭ Ϭ Ϭ Ϭ͘ϵϳ ϰϲ͘ϳϯϴϳ Ϭ Ϭ Ϭ Ϭ Ϭ zĞĂƌ ϮϬϮϮ^ĞĂƐŽŶ ŵŝƐƐŝŽŶdǇƉĞ > >dϭ >dϮ Ds >,ϭ >,Ϯ D, ,, Kh^ hh^ Dz ^h^ D,,ϰͺ/>yϬϬϬϬϬ͘ϬϬϱϴϰϯ Ϭ͘ϬϬϯϲϭϯ Ϭ͘ϬϭϰϴϵϮ Ϭ͘ϮϲϬϳϵϵϱϯϰ Ϭ͘ϬϬϴϭϱϵ Ϭ Ϭ Ϭ͘ϬϴϲϮϴ Ϭ,ϰͺZhEyϬ͘ϬϬϮϯϭϵ Ϭ͘ϬϬϲϮϴϳ Ϭ͘ϬϬϮϲϬϮ Ϭ͘ϬϬϯϮϬϭ Ϭ͘ϬϬϳϯϴϰ Ϭ͘ϬϬϲϳϭϴ Ϭ͘ϬϭϮϱϮϴ Ϭ͘Ϯϳϵϲϴϲϵϰϵ Ϭ͘ϬϬϴϮϱϮ Ϭ͘ϭϲϭϬϭϬϰϱϵ Ϭ͘ϭϱϵϰϰϵ Ϭ͘Ϭϴϱϴϵϱ Ϭ͘ϬϭϯϳϬϴ,ϰͺ^dZyϬ͘ϬϳϭϴϮϱ Ϭ͘ϭϬϴϴϱϯ Ϭ͘ϬϴϬϱϰϭ Ϭ͘Ϭϵϱϱϭϰ Ϭ͘ϬϮϰϬϯϮ Ϭ͘Ϭϭϰϰϵϴ Ϭ͘Ϭϭϭϴϲϱ ϲ͘ϳϳϱϯϰͲϬϳ Ϭ͘Ϭϭϭϯϰ Ϭ͘ϬϬϳϳϳϰϵϭϴ Ϭ͘ϭϵϭϯϴϵ Ϭ͘ϬϬϳϵϵϴ Ϭ͘ϬϮϳϵϬϮKͺ/>yϬϬϬϬϬ͘ϮϬϱϳϵϲ Ϭ͘ϭϱϮϱϮϴ Ϭ͘ϲϱϰϴϵϮ ϰ͘ϰϰϬϵϰϰϬϵϯ Ϭ͘ϰϲϯϵϯϲ Ϭ Ϭ Ϯ͘Ϭϳϯϭϲϯ ϬKͺZhEyϬ͘ϲϲϯϲϴϴ ϭ͘ϯϲϯϴϭϱ Ϭ͘ϳϯϴϮϯϳ Ϭ͘ϴϬϮϴϵ Ϭ͘ϴϳϭϬϳ Ϭ͘ϱϳϱϯϴϴ Ϭ͘ϱϵϱϱϳϱ ϭ͘ϲϵϮϯϰϬϳϵϭ Ϭ͘ϯϬϲϲϯϳ Ϯ͘ϬϱϵϱϮϳϮϲϱ ϭϮ͘ϯϯϬϭϱ ϭ͘ϴϭϮϬϴϭ ϭ͘ϱϭϴϬϯϯKͺ^dZyϯ͘ϯϰϱϯϲϲ ϱ͘ϲϬϱϬϭϵ ϯ͘ϲϴϭϭϲϴ ϯ͘ϵϱϰϴϭ Ϯ͘ϰϯϮϵϴϮ ϭ͘ϰϱϴϱϳϴ ϭ͘ϰϳϳϴϱϯ Ϭ͘ϬϯϰϳϰϱϱϮϰ ϭ͘ϭϴϬϵϴϮ Ϭ͘ϴϮϲϴϭϰϳϮϱ ϳ͘ϵϲϯϯϳϳ ϭ͘ϭϴϰϱϴϳ Ϯ͘ϳϰϵϯϮϮKϮͺE/Kͺ/>yϬϬϬϬϴ͘ϲϰϲϭϳϵ ϭϯ͘ϯϱϯϱϰ ϭϱϳ͘ϭϳϯϵ ϴϭϳ͘ϱϱϳϵϮϮϯ ϵϮ͘Ϯϯϭϴϵ Ϭ Ϭ ϮϬϲ͘ϳϭϮϮ ϬKϮͺE/KͺZhEyϮϱϵ͘ϲϵϭϰ ϯϯϬ͘Ϭϰϵϱ ϯϰϬ͘ϲϭϬϰ ϰϬϵ͘ϭϵϵϰ ϴϬϮ͘ϴϯϳϵ ϴϰϱ͘ϰϯϰϯ ϭϮϴϵ͘ϴϳ ϭϴϰϳ͘Ϭϵϳϱϰϴ ϭϯϰϰ͘ϯϴϭ ϭϯϵϱ͘ϱϴϯϳϳϰ ϭϴϴ͘ϲϵϮ ϭϬϮϭ͘ϭϬϲ ϭϲϳϱ͘ϱϰKϮͺE/Kͺ^dZyϲϳ͘ϰϳϴϴϴ ϴϳ͘ϲϯϳϳϯ ϴϳ͘Ϭϵϵϯϴ ϭϬϰ͘Ϭϴϯϴ ϮϬ͘ϭϴϮϰϯ ϭϭ͘ϱϰϬϳϯ ϭϭ͘ϬϬϴϬϯ Ϭ͘ϯϭϰϭϲϯϵϳϮ ϭϬ͘ϮϲϱϮϮ ϱ͘ϳϱϴϱϱϴϬϭϯ ϱϬ͘ϬϳϭϬϮ ϱ͘ϰϴϵϭϮϭ Ϯϯ͘ϬϰϬϴϮEKyͺ/>yϬϬϬϬϬ͘Ϭϰϭϰϵ Ϭ͘ϬϴϮϯϵϲ ϭ͘ϬϭϯϱϮϯ ϰ͘ϰϯϯϱϴϴϳϰϮ Ϭ͘ϰϮϳϴϬϰ Ϭ Ϭ ϭ͘ϱϳϳϭϮϵ ϬEKyͺZhEyϬ͘Ϭϰϯϴϳ Ϭ͘ϭϯϰϲϰϰ Ϭ͘Ϭϲϭϳϳϰ Ϭ͘ϬϴϬϲϮϭ Ϭ͘ϱϱϲϱϭϵ Ϭ͘ϳϮϵϴϱϲ ϭ͘ϱϴϳϬϲϴ ϯ͘ϮϱϲϯϬϱϭϮϰ Ϭ͘ϵϯϳϵϴϰ Ϯ͘ϰϱϯϮϭϰϳϱϱ Ϭ͘ϱϲϯϯϳϲ ϯ͘ϯϭϵϱϬϴ ϭ͘ϯϵϮϳϴϭEKyͺ^dZyϬ͘ϮϱϰϴϮϱ Ϭ͘ϯϵϯϳϮϰ Ϭ͘ϯϮϬϳϴϮ Ϭ͘ϯϵϱϮϵϴ Ϭ͘ϰϲϱϳϵϳ Ϭ͘Ϯϴϰϳϰϴ ϭ͘ϮϬϯϱϲϯ Ϯ͘ϯϴϵϱϰϳϱϯϭ ϭ͘ϬϲϰϵϮϮ Ϭ͘ϬϴϮϲϮϵϯϬϳ Ϭ͘ϭϰϴϭϰϱ Ϭ͘ϰϯϲϰϱϮ Ϭ͘ϮϴϴϱϮϭWDϭϬͺ/>yϬϬϬϬϬ͘ϬϬϬϱϴϯ Ϭ͘ϬϬϭϮϰϮ Ϭ͘ϬϬϯϭϵϯ Ϭ͘ϬϬϯϴϮϳϬϱ Ϭ͘ϬϬϬϮϱϴ Ϭ Ϭ Ϭ͘ϬϬϭϴϲϴ ϬWDϭϬͺWDtϬ͘ϬϬϲϰϳϯ Ϭ͘ϬϬϴϬϵϮ Ϭ͘ϬϬϳϳϭϰ Ϭ͘ϬϬϳϳϲϯ Ϭ͘Ϭϳϴ Ϭ͘Ϭϵϭ Ϭ͘Ϭϰϱϱϯϳ Ϭ͘Ϭϵϱϵϲϲϯϰϯ Ϭ͘Ϭϰϴϴϳϱ Ϭ͘ϭϬϴϱϬϯϳϵϱ Ϭ͘ϬϭϮ Ϭ͘Ϭϰϱϴϱϲ Ϭ͘ϬϰϰϵϰϰWDϭϬͺWDdtϬ͘ϬϬϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϮϬϱ Ϭ͘ϬϭϬϱϬϯ Ϭ͘ϬϭϮ Ϭ͘Ϭϯϰϰϴϵϵϱϳ Ϭ͘ϬϭϮ Ϭ͘ϬϮϵϯϲϮϮϭϮ Ϭ͘ϬϬϰ Ϭ͘ϬϭϬϰϬϭ Ϭ͘ϬϭϯϮϲϯWDϭϬͺZhEyϬ͘ϬϬϭϮϴϰ Ϭ͘ϬϬϭϵϴϭ Ϭ͘ϬϬϭϯϴϳ Ϭ͘ϬϬϭϰϱϮ Ϭ͘ϬϭϭϬϰϰ Ϭ͘Ϭϭϳϴϴϯ Ϭ͘Ϭϭϵϰϱϵ Ϭ͘ϬϮϱϴϯϴϯϱϴ Ϭ͘ϬϬϵϮϰϰ Ϭ͘ϬϬϲϴϰϭϵϬϮ Ϭ͘ϬϬϮϬϬϳ Ϭ͘ϬϭϱϬϲϯ Ϭ͘ϬϮϮϭϴϱWDϭϬͺ^dZyϬ͘ϬϬϮϭϰϴ Ϭ͘ϬϬϯϬϯϯ Ϭ͘ϬϬϮϭϵϮ Ϭ͘ϬϬϮϯϰϯ Ϭ͘ϬϬϬϮϮϲ Ϭ͘ϬϬϬϭϮϰ Ϭ͘ϬϬϬϭϰϰ ϱ͘ϴϬϵϯϯͲϬϲ Ϭ͘ϬϬϬϭϬϯ ϭ͘ϱϯϯϯϭͲϬϱ Ϭ͘ϬϬϰϬϳ ϳ͘ϯͲϬϱ Ϭ͘ϬϬϬϯϲϲWDϮϱͺ/>yϬϬϬϬϬ͘ϬϬϬϱϱϴ Ϭ͘ϬϬϭϭϴϴ Ϭ͘ϬϬϯϬϱϱ Ϭ͘ϬϬϯϲϱϳϭ Ϭ͘ϬϬϬϮϰϳ Ϭ Ϭ Ϭ͘ϬϬϭϳϴϲ ϬWDϮϱͺWDtϬ͘ϬϬϮϮϲϲ Ϭ͘ϬϬϮϴϯϮ Ϭ͘ϬϬϮϳ Ϭ͘ϬϬϮϳϭϳ Ϭ͘ϬϮϳϯ Ϭ͘Ϭϯϭϴϱ Ϭ͘Ϭϭϱϵϯϴ Ϭ͘ϬϯϯϱϴϴϮϮ Ϭ͘ϬϭϳϭϬϲ Ϭ͘ϬϯϳϵϳϲϯϮϴ Ϭ͘ϬϬϰϮ Ϭ͘ϬϭϲϬϱ Ϭ͘ϬϭϱϳϯWDϮϱͺWDdtϬ͘ϬϬϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϬϭ Ϭ͘ϬϬϮϲϮϲ Ϭ͘ϬϬϯ Ϭ͘ϬϬϴϲϮϮϰϴϵ Ϭ͘ϬϬϯ Ϭ͘ϬϬϳϯϰϬϱϱϯ Ϭ͘ϬϬϭ Ϭ͘ϬϬϮϲ Ϭ͘ϬϬϯϯϭϲWDϮϱͺZhEyϬ͘ϬϬϭϭϴϮ Ϭ͘ϬϬϭϴϮϯ Ϭ͘ϬϬϭϮϳϲ Ϭ͘ϬϬϭϯϯϴ Ϭ͘ϬϭϬϱϮϱ Ϭ͘ϬϭϳϬϴϳ Ϭ͘ϬϭϴϲϬϲ Ϭ͘ϬϮϰϳϭϰϬϯϱ Ϭ͘ϬϬϴϴϯϳ Ϭ͘ϬϬϲϱϰϭϯϮϮ Ϭ͘ϬϬϭϴϴ Ϭ͘Ϭϭϰϯϴϰ Ϭ͘ϬϮϭϭϳϰWDϮϱͺ^dZyϬ͘ϬϬϭϵϳϱ Ϭ͘ϬϬϮϳϴϵ Ϭ͘ϬϬϮϬϭϲ Ϭ͘ϬϬϮϭϱϰ Ϭ͘ϬϬϬϮϬϴ Ϭ͘ϬϬϬϭϭϰ Ϭ͘ϬϬϬϭϯϯ ϱ͘ϯϰϭϰϳͲϬϲ ϵ͘ϰϯͲϬϱ ϭ͘ϰϬϵϴϮͲϬϱ Ϭ͘ϬϬϯϴϯϲ ϲ͘ϳϮͲϬϱ Ϭ͘ϬϬϬϯϯϲZK'ͺ/hZEϬ͘Ϯϲϴϯϱ Ϭ͘ϱϰϭϳϬϵ Ϭ͘ϮϮϭϭϬϳ Ϭ͘Ϯϱϴϱϳϵ Ϭ͘ϭϬϲϲϵϵ Ϭ͘ϬϲϳϱϮϲ Ϭ͘ϬϯϯϵϮϳ Ϭ͘ϬϬϬϵϵϬϵϭϭ Ϭ͘Ϭϯϭϰϲϲ Ϭ͘ϬϮϬϲϯϮϱϮϰ ϯ͘ϱϵϭϮϲϳ Ϭ͘ϬϰϴϮϭ ϯϬ͘ϵϵϮϵϮZK'ͺ,d^<Ϭ͘ϬϴϯϱϬϭ Ϭ͘ϭϱϲϵϲϴ Ϭ͘Ϭϲϳϯϭϴ Ϭ͘ϬϳϲϮϬϭ Ϭ͘ϬϮϵϱϳϳ Ϭ͘ϬϭϴϵϮϯ Ϭ͘ϬϬϴϴϭϱ Ϭ͘ϬϬϬϮϳϳϬϬϳ Ϭ͘ϬϬϴϵϭϰ Ϭ͘ϬϬϴϮϯϱϮϲϮ ϯ͘ϱϱϵϬϯϵ Ϭ͘Ϭϭϯϯϴϳ ϵ͘ϬϴϭϰϭϴZK'ͺ/>yϬϬϬϬϬ͘ϬϮϯϭϱϭ Ϭ͘ϬϭϳϮϵϲ Ϭ͘ϬϯϬϵϯϭ Ϭ͘ϮϵϮϴϬϯϯϴϲ Ϭ͘ϬϯϯϮϭϰ Ϭ Ϭ Ϭ͘ϮϰϬϭϰϳ ϬZK'ͺZ^d>ϬϬϬϬϬϬϬ ϬϬ ϬϬϬϬZK'ͺZhEyϬ͘ϬϬϵϮϴϲ Ϭ͘ϬϮϴϯϱϮ Ϭ͘ϬϭϬϮϯϭ Ϭ͘Ϭϭϯϰϳϰ Ϭ͘Ϭϳϯϳϵϲ Ϭ͘ϭϬϭϬϴϳ Ϭ͘Ϭϲϳϳϱϲ Ϭ͘Ϭϰϳϴϴϴϴϯϰ Ϭ͘ϬϯϯϰϮϰ Ϭ͘ϭϯϱϳϯϰϭ ϭ͘ϬϱϰϵϮϮ Ϭ͘ϬϵϱϴϮϭ Ϭ͘ϬϴϲϯϴϵZK'ͺZhE>^Ϭ͘Ϯϭϭϳϲϳ Ϭ͘ϰϱϰϰϮϵ Ϭ͘ϭϲϵϵϭϳ Ϭ͘ϮϬϯϭϭϮ Ϭ͘ϭϱϳϱϵϯ Ϭ͘Ϭϵϵϲϵϱ Ϭ͘ϬϳϮϱϳϭ Ϭ͘ϬϬϮϮϴϲϱϯ Ϭ͘Ϭϯϳϱϯϵ Ϭ͘ϬϭϯϯϳϮϲϲϯ ϯ͘ϳϮϮϯϳϭ Ϭ͘Ϭϯϴϴϰϭ Ϭ͘ϮϭϮϮϭϰZK'ͺ^dZyϬ͘ϯϰϭϬϳϳ Ϭ͘ϱϲϳϴϰ Ϭ͘ϯϳϯϴϰ Ϭ͘ϰϳϳϱϬϴ Ϭ͘ϭϭϳϵϵϯ Ϭ͘Ϭϳϭϴϯϲ Ϭ͘Ϭϲϲϱϲ ϯ͘ϲϳϳϲϲͲϬϲ Ϭ͘ϬϱϲϬϭϮ Ϭ͘ϬϯϬϭϭϵϴϭϱ ϭ͘ϰϯϮϲϳ Ϭ͘Ϭϰϲϱϭϯ Ϭ͘ϭϮϭϵϯϭ^KϮͺ/>yϬϬϬϬϴ͘ϰϰͲϬϱϬ͘ϬϬϬϭϮϴ Ϭ͘ϬϬϭϰϲ Ϭ͘ϬϬϲϵϳϲϬϵϳ Ϭ͘ϬϬϬϴϲϳ Ϭ Ϭ Ϭ͘ϬϬϭϴϵϳ Ϭ^KϮͺZhEyϬ͘ϬϬϮϱϲϳ Ϭ͘ϬϬϯϮϲϯ Ϭ͘ϬϬϯϯϲϳ Ϭ͘ϬϬϰϬϰϯ Ϭ͘ϬϬϳϴϱϴ Ϭ͘ϬϬϴϭϲϯ Ϭ͘ϬϭϮϮϴϯ Ϭ͘ϬϭϲϯϳϵϱϬϳ Ϭ͘ϬϭϮϳϴϲ Ϭ͘ϬϭϮϴϯϭϭϲϯ Ϭ͘ϬϬϭϴϲϱ Ϭ͘ϬϬϵϱϳϯ Ϭ͘ϬϭϲϰϮϰ^KϮͺ^dZyϬ͘ϬϬϬϲϲϳ Ϭ͘ϬϬϬϴϲϲ Ϭ͘ϬϬϬϴϲϭ Ϭ͘ϬϬϭϬϮϵ Ϭ͘ϬϬϬϮ Ϭ͘ϬϬϬϭϭϰ Ϭ͘ϬϬϬϭϬϵ ϯ͘ϭϬϱϴϯͲϬϲ Ϭ͘ϬϬϬϭϬϭ ϱ͘ϲϵϮϵϮͲϬϱ Ϭ͘ϬϬϬϰϵϱ ϱ͘ϰϯͲϬϱ Ϭ͘ϬϬϬϮϮϴdK'ͺ/hZEϬ͘Ϯϲϴϯϱ Ϭ͘ϱϰϭϳϬϵ Ϭ͘ϮϮϭϭϬϳ Ϭ͘Ϯϱϴϱϳϵ Ϭ͘ϭϬϲϲϵϵ Ϭ͘ϬϲϳϱϮϲ Ϭ͘ϬϯϯϵϮϳ Ϭ͘ϬϬϬϵϵϬϵϭϭ Ϭ͘Ϭϯϭϰϲϲ Ϭ͘ϬϮϬϲϯϮϱϮϰ Ϭ͘Ϭϳϵϳϴϱ Ϭ͘ϬϰϴϮϭ ϯϬ͘ϵϵϮϵϮdK'ͺ,d^<Ϭ͘ϬϴϯϱϬϭ Ϭ͘ϭϱϲϵϲϴ Ϭ͘Ϭϲϳϯϭϴ Ϭ͘ϬϳϲϮϬϭ Ϭ͘ϬϮϵϱϳϳ Ϭ͘ϬϭϴϵϮϯ Ϭ͘ϬϬϴϴϭϱ Ϭ͘ϬϬϬϮϳϳϬϬϳ Ϭ͘ϬϬϴϵϭϰ Ϭ͘ϬϬϴϮϯϱϮϲϮ ϯ͘ϱϱϵϬϯϵ Ϭ͘Ϭϭϯϯϴϳ ϵ͘ϬϴϭϰϭϴdK'ͺ/>yϬϬϬϬϬ͘ϬϯϯϬϱϵ Ϭ͘ϬϮϯϲϴϳ Ϭ͘ϬϱϬϬϯϰ Ϭ͘ϱϴϭϳϵϮϴϭϯ Ϭ͘Ϭϰϱϱϴϳ Ϭ Ϭ Ϭ͘ϯϳϵϴϱϰ ϬdK'ͺZ^d>ϬϬϬϬϬϬϬ ϬϬ ϬϬϬϬdK'ͺZhEyϬ͘ϬϭϯϱϮϲ Ϭ͘ϬϰϭϯϮϴ Ϭ͘ϬϭϰϵϬϵ Ϭ͘Ϭϭϵϱϴϴ Ϭ͘ϬϵϮϭϬϵ Ϭ͘ϭϭϴϵϵ Ϭ͘Ϭϴϵϴϲϳ Ϭ͘ϯϯϯϵϳϮϱϮϭ Ϭ͘ϬϰϲϭϮϮ Ϭ͘ϯϭϬϬϮϬϳϳϱ ϭ͘ϮϱϵϴϮϭ Ϭ͘ϭϵϵϵϵϰ Ϭ͘ϭϭϲϬϳdK'ͺZhE>^Ϭ͘Ϯϭϭϳϲϳ Ϭ͘ϰϱϰϰϮϵ Ϭ͘ϭϲϵϵϭϳ Ϭ͘ϮϬϯϭϭϮ Ϭ͘ϭϱϳϱϵϯ Ϭ͘Ϭϵϵϲϵϱ Ϭ͘ϬϳϮϱϳϭ Ϭ͘ϬϬϮϮϴϲϱϯ Ϭ͘Ϭϯϳϱϯϵ Ϭ͘ϬϭϯϯϳϮϲϲϯ ϯ͘ϳϮϮϯϳϭ Ϭ͘Ϭϯϴϴϰϭ Ϭ͘ϮϭϮϮϭϰdK'ͺ^dZyϬ͘ϯϳϯϰϯϰ Ϭ͘ϲϮϭϳϭϭ Ϭ͘ϰϬϵϯϬϳ Ϭ͘ϱϮϮϴϬϳ Ϭ͘ϭϮϵϭϴϴ Ϭ͘ϬϳϴϲϱϮ Ϭ͘ϬϳϮϴϳϱ ϰ͘ϬϮϲϱϳͲϬϲ Ϭ͘ϬϲϭϯϮϲ Ϭ͘ϬϯϮϵϳϳϰϬϲ ϭ͘ϱϱϳϭϱϲ Ϭ͘ϬϱϬϵϮϲ Ϭ͘ϭϯϯϰϵϵEϮKͺ/>y ϬϬϬϬϬ͘ϬϬϬϱϳϵ Ϭ͘ϬϬϭϱϯϵ Ϭ͘ϬϮϰϬϮ Ϭ͘ϭϯϮϱϱϬϴϲ Ϭ͘Ϭϭϯϲϳϴ Ϭ Ϭ Ϭ͘ϬϮϱϵϵϱ Ϭ EϮKͺZhEy Ϭ͘ϬϬϰϱϭϳ Ϭ͘ϬϬϵϱϭϲ Ϭ͘ϬϬϱϱϯϳ Ϭ͘ϬϬϳϭϲϴ Ϭ͘Ϭϯϲϭϯϴ Ϭ͘Ϭϳϴϳϭϲ Ϭ͘ϭϱϮϮϴϱ Ϭ͘ϮϵϱϰϵϯϬϯϭ Ϭ͘ϭϲϲϴϮϱ Ϭ͘ϮϬϮϵϯϯϱϱϭ Ϭ͘Ϭϯϴϴϱϵ Ϭ͘ϭϮϰϮϴϯ Ϭ͘ϬϳϮϳϲϳ EϮKͺ^dZy Ϭ͘ϬϯϭϭϯϮ Ϭ͘ϬϯϴϲϮ Ϭ͘ϬϯϲϬϴϴ Ϭ͘ϬϯϴϳϮϲ Ϭ͘Ϭϯϴϰϰϳ Ϭ͘ϬϮϮϱϰϭ Ϭ͘ϬϬϳϴϲϮ ϳ͘ϳϭϵϱϮͲϬϳ Ϭ͘ϬϭϬϴϬϰ Ϭ͘ϬϭϬϴϬϴϮϵϭ Ϭ͘ϬϬϴϲϳϭ Ϭ͘ϬϬϰϴϱϳ Ϭ͘ϬϮϵϰϱϯĂůDŽĚD&ϮϬϮϭŵŝƐƐŝŽŶ&ĂĐƚŽƌƐ/ŶƉƵƚ zĞĂƌ ϮϬϮϮ&ůĞĞƚDŝǆ>ĂŶĚhƐĞ^ƵďdǇƉĞ > >dϭ >dϮ Ds >,ϭ >,Ϯ D, ,, Kh^ hh^ Dz ^h^ D,ZĞƐĞĂƌĐŚΘĞǀĞůŽƉŵĞŶƚϬ͘ϰϵϱϭϭ Ϭ͘ϬϰϱϳϬϴ Ϭ͘ϮϰϲϲϮϱ Ϭ͘ϭϰϬϰϵϭ Ϭ͘ϬϮϲϲϱϵ Ϭ͘ϬϬϱϰϰϰ Ϭ͘ϬϬϵϯϰϱ Ϭ͘ϬϬϮϳϭϰϬ͘ϬϬϮϰϯϴ Ϭ͘ϬϬϬϴϮϴ Ϭ͘ϬϮϮϮϭϲ Ϭ͘ϬϬϬϰϯϳ Ϭ͘ϬϬϭϵϴϱĂůDŽĚD&ϮϬϮϭ&ůĞĞƚDŝǆ/ŶƉƵƚ zĞĂƌ ϮϬϮϴ^ĞĂƐŽŶ ŵŝƐƐŝŽŶdǇƉĞ > >dϭ >dϮ Ds >,ϭ >,Ϯ D, ,, Kh^ hh^ Dz ^h^ D,,ϰͺ/>yϬϬϬϬϬ͘ϬϬϰϰϳϱ Ϭ͘ϬϬϮϰϵϴ Ϭ͘Ϭϭϱϳϳϭ Ϭ͘Ϯϰϰϱϴϵϭϱϲ Ϭ͘ϬϬϲϴϭϵ Ϭ Ϭ Ϭ͘ϭϬϲϭϵϳ Ϭ,ϰͺZhEyϬ͘ϬϬϭϮϰϳ Ϭ͘ϬϬϮϴϬϴ Ϭ͘ϬϬϭϱϴϲ Ϭ͘ϬϬϭϲϯϲ Ϭ͘ϬϬϯϳϬϱ Ϭ͘ϬϬϰϬϬϯ Ϭ͘ϬϬϵϴϴϵ Ϭ͘ϮϭϬϯϴϱϬϰϲ Ϭ͘ϬϬϵϬϵ Ϭ͘ϱϵϱϲϱϵϲϭϲ Ϭ͘ϭϯϮϲϳϱ Ϭ͘ϬϳϲϬϮϮ Ϭ͘ϬϬϱϴϯϭ,ϰͺ^dZyϬ͘Ϭϰϴϲϭϯ Ϭ͘Ϭϲϱϰϵϰ Ϭ͘Ϭϱϱϰϯ Ϭ͘ϬϱϴϰϮϯ Ϭ͘ϬϭϲϯϬϯ Ϭ͘ϬϬϴϰϵϭ Ϭ͘ϬϬϵϳϰϵ ϰ͘ϭϳϯϴϵͲϬϳ Ϭ͘ϬϬϵϬϭϰ Ϭ͘ϬϬϰϱϰϯϭϬϰ Ϭ͘ϭϱϭϭϬϳ Ϭ͘ϬϬϴϵϬϯ Ϭ͘ϬϮϮϰϳϵKͺ/>yϬϬϬϬϬ͘ϭϵϭϰϵ Ϭ͘ϭϯϵϰϲϴ Ϭ͘ϲϱϯϳϮϲ ϰ͘ϲϰϬϬϮϱϵϭϯ Ϭ͘ϱϬϬϬϮϮ Ϭ Ϭ Ϯ͘ϲϳϲϵϯϴ ϬKͺZhEyϬ͘ϰϲϬϲϰϯ Ϭ͘ϳϲϰϮϮϲ Ϭ͘ϱϰϮϬϮϱ Ϭ͘ϱϰϬϲϱϳ Ϭ͘ϱϲϭϬϯϯ Ϭ͘ϯϱϯϭϳϴ Ϭ͘ϮϭϬϵϰϭ ϭ͘ϱϰϲϲϮϵϯϳϴ Ϭ͘ϭϳϱϳϬϳ ϲ͘ϴϱϳϳϴϵϱϲϰ ϵ͘ϵϳϭϯϮϲ ϭ͘Ϭϴϭϭϯϰ Ϭ͘ϰϬϬϮϴϮKͺ^dZyϮ͘ϯϮϰϴϲϵ ϯ͘Ϯϵϯϴϰϳ Ϯ͘ϲϮϯϵϭϵ Ϯ͘ϲϯϵϭϲ Ϯ͘ϮϵϬϰϲϰ ϭ͘ϮϯϬϬϱϰ ϭ͘ϬϴϮϰϬϮ Ϭ͘ϬϮϬϳϰϯϲϬϴ Ϭ͘ϵϭϰϲϵϲ Ϭ͘ϴϴϱϭϳϵϬϰϱ ϳ͘ϲϬϭϱϯϲ ϭ͘ϮϮϱϰϭϮ ϭ͘ϵϴϲϯϰϱKϮͺE/Kͺ/>yϬϬϬϬϳ͘ϴϰϲϮϭϯ ϭϮ͘ϵϰϬϱϲ ϭϯϴ͘ϲϭϴϴ ϳϮϰ͘ϴϰϵϴϳϯϯ ϵϬ͘Ϭϯϰ Ϭ Ϭ ϮϬϰ͘ϰϭϰϭ ϬKϮͺE/KͺZhEyϮϮϬ͘ϯϳϯϵ Ϯϴϴ͘ϯϯϰϴ Ϯϵϭ͘ϵϱϳϳ ϯϰϳ͘ϴϮϲϮ ϲϵϬ͘ϭϱϴϮ ϳϮϴ͘ϭϯϱϴ ϭϭϴϬ͘ϱϴϲ ϭϲϭϱ͘Ϯϳϯϳϵϱ ϭϮϯϲ͘Ϯϯϵ ϭϬϭϳ͘ϯϬϰϮϰϵ ϭϴϱ͘ϱϱϳϴ ϵϬϲ͘ϴϳϯϲ ϭϲϲϭ͘ϭϭϵKϮͺE/Kͺ^dZyϱϳ͘ϰϭϵϵϴ ϳϰ͘ϮϰϬϯϭ ϳϯ͘ϴϬϮϲϮ ϴϳ͘ϰϮϱϭϴ ϭϳ͘ϰϱϳϯϳ ϵ͘ϬϲϰϮϯϯ ϵ͘ϵϵϬϯϮ Ϭ͘Ϯϯϵϴϳϵϯϭϱ ϴ͘Ϯϴϴϭϴϭ ϱ͘ϯϭϱϰϮϲϯϬϮ ϰϭ͘ϮϴϮϳ ϲ͘ϰϮϲϮϴϴ ϮϬ͘ϰϭϮϳϭEKyͺ/>yϬϬϬϬϬ͘ϬϯϬϯϴ Ϭ͘ϬϲϮϴϵϮ Ϭ͘ϲϱϴϬϭϯ ϯ͘ϰϳϱϮϲϴϯϱϯ Ϭ͘ϯϲϬϯϯϭ Ϭ Ϭ ϭ͘ϭϱϮϰϰϮ ϬEKyͺZhEyϬ͘ϬϮϰϭϭϭ Ϭ͘ϬϲϬϬϱϳ Ϭ͘Ϭϯϯϯϲϰ Ϭ͘Ϭϯϱϯϲϯ Ϭ͘ϮϯϮϱϵϱ Ϭ͘ϯϯϴϲϳϲ Ϭ͘ϳϬϮϲϰ Ϯ͘ϭϭϲϬϵϭϱϯϭ Ϭ͘ϲϳϮϬϭϭ Ϭ͘ϮϮϴϵϵϬϮϲϲ Ϭ͘ϰϴϬϳϳϰ ϭ͘ϴϲϰϴϲϭ ϭ͘ϬϰϬϲϰϳEKyͺ^dZyϬ͘ϭϴϴϯϳϴ Ϭ͘ϮϱϳϯϲϮ Ϭ͘ϮϮϯϰϱ Ϭ͘ϮϰϬϭϮϭ Ϭ͘ϯϯϬϬϱϴ Ϭ͘ϭϳϳϱϲϳ ϭ͘ϮϮϮϲϭϰ Ϯ͘ϳϯϬϵϱϳϳϮϰ ϭ͘ϬϵϮϴϰϮ Ϭ͘ϬϰϲϬϯϮϲϰ Ϭ͘Ϭϵϳϳϭϳ Ϭ͘ϰϵϴϯϮϰ Ϭ͘ϮϲϬϬϰϵWDϭϬͺ/>yϬϬϬϬϬ͘ϬϬϬϲϮϲ Ϭ͘ϬϬϭϯϵϵ Ϭ͘ϬϬϬϵϲϳ Ϭ͘ϬϬϮϰϲϯϮϮϭ Ϭ͘ϬϬϬϮϭϴ Ϭ Ϭ Ϭ͘ϬϬϬϵϵϰ ϬWDϭϬͺWDtϬ͘ϬϬϲϯϲϳ Ϭ͘ϬϬϳϵϴϭ Ϭ͘ϬϬϳϳϯϳ Ϭ͘ϬϬϳϳϱϳ Ϭ͘Ϭϳϱϳϱϴ Ϭ͘ϬϴϴϮϮϯ Ϭ͘Ϭϰϰϰϱϵ Ϭ͘ϬϵϰϬϭϬϮϯϭ Ϭ͘Ϭϰϴϵϳϵ Ϭ͘ϭϰϵϳϵϮϬϮ Ϭ͘ϬϭϮ Ϭ͘ϬϰϰϬϰϮ Ϭ͘ϬϰϰϵϰϭWDϭϬͺWDdtϬ͘ϬϬϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϴ Ϭ͘ϬϬϵϯϬϭ Ϭ͘ϬϭϬϱϲϰ Ϭ͘ϬϭϮ Ϭ͘ϬϯϰϱϮϲϳϲ Ϭ͘ϬϭϮ Ϭ͘Ϭϱϲϳϴϭϳϯϰ Ϭ͘ϬϬϰ Ϭ͘ϬϬϵϵϰϴ Ϭ͘ϬϭϯϯϮϱWDϭϬͺZhEyϬ͘ϬϬϬϵϭϴ Ϭ͘ϬϬϭϮϮϴ Ϭ͘ϬϬϭϬϬϱ Ϭ͘ϬϬϬϵϴϲ Ϭ͘ϬϬϳϮϳϭ Ϭ͘ϬϭϯϬϵϲ Ϭ͘ϬϬϳϮϱϴ Ϭ͘ϬϮϭϵϭϮϱϴϮ Ϭ͘ϬϬϳϵϬϮ Ϭ͘ϬϬϰϯϮϬϲϱϳ Ϭ͘ϬϬϮϬϲ Ϭ͘ϬϬϴϳϰϯ Ϭ͘ϬϭϯϬϳϱWDϭϬͺ^dZyϬ͘ϬϬϭϲϰϲ Ϭ͘ϬϬϮϬϯϮ Ϭ͘ϬϬϭϲϴϭ Ϭ͘ϬϬϭϲϱϲ Ϭ͘ϬϬϬϭϮϴ ϱ͘ϴϰͲϬϱ Ϭ͘ϬϬϬϭϮϯ Ϯ͘ϵϴϯϲϵͲϬϲ ϴ͘ϴϵͲϬϱ Ϯ͘ϰϴϴϬϰͲϬϱ Ϭ͘ϬϬϯϲϴϯ ϴ͘ϴϴͲϬϱ Ϭ͘ϬϬϬϮϲϰWDϮϱͺ/>yϬϬϬϬϬ͘ϬϬϬϱϵϵ Ϭ͘ϬϬϭϯϯϵ Ϭ͘ϬϬϬϵϮϱ Ϭ͘ϬϬϮϯϱϬϲϬϱ Ϭ͘ϬϬϬϮϬϵ Ϭ Ϭ Ϭ͘ϬϬϬϵϰϵ ϬWDϮϱͺWDtϬ͘ϬϬϮϮϮϴ Ϭ͘ϬϬϮϳϵϯ Ϭ͘ϬϬϮϳϬϴ Ϭ͘ϬϬϮϳϭϱ Ϭ͘ϬϮϲϱϭϱ Ϭ͘ϬϯϬϴϳϴ Ϭ͘Ϭϭϱϱϲϭ Ϭ͘ϬϯϮϵϬϯϱϴϭ Ϭ͘Ϭϭϳϭϰϯ Ϭ͘ϬϱϮϰϮϳϮϬϳ Ϭ͘ϬϬϰϮ Ϭ͘Ϭϭϱϰϭϱ Ϭ͘ϬϭϱϳϮϵWDϮϱͺWDdtϬ͘ϬϬϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮ Ϭ͘ϬϬϮϯϮϱ Ϭ͘ϬϬϮϲϰϭ Ϭ͘ϬϬϯ Ϭ͘ϬϬϴϲϯϭϲϵ Ϭ͘ϬϬϯ Ϭ͘Ϭϭϰϭϵϱϰϯϯ Ϭ͘ϬϬϭ Ϭ͘ϬϬϮϰϴϳ Ϭ͘ϬϬϯϯϯϭWDϮϱͺZhEyϬ͘ϬϬϬϴϰϰ Ϭ͘ϬϬϭϭϯ Ϭ͘ϬϬϬϵϮϱ Ϭ͘ϬϬϬϵϬϳ Ϭ͘ϬϬϲϵϮϰ Ϭ͘ϬϭϮϱϭϱ Ϭ͘ϬϬϲϵϯϮ Ϭ͘ϬϮϬϵϱϴϱϯϳ Ϭ͘ϬϬϳϱϱϰ Ϭ͘ϬϬϰϭϮϳϳϲϲ Ϭ͘ϬϬϭϵϮϯ Ϭ͘ϬϬϴϯϰϭ Ϭ͘ϬϭϮϰϳϭWDϮϱͺ^dZyϬ͘ϬϬϭϱϭϰ Ϭ͘ϬϬϭϴϲϵ Ϭ͘ϬϬϭϱϰϲ Ϭ͘ϬϬϭϱϮϮ Ϭ͘ϬϬϬϭϭϳ ϱ͘ϯϳͲϬϱ Ϭ͘ϬϬϬϭϭϯ Ϯ͘ϳϰϯϰͲϬϲ ϴ͘ϭϴͲϬϱ Ϯ͘ϮϴϳϲϲͲϬϱ Ϭ͘ϬϬϯϰϰϳ ϴ͘ϭϳͲϬϱ Ϭ͘ϬϬϬϮϰϮZK'ͺ/hZEϬ͘ϮϮϭϵϱ Ϭ͘ϯϰϴϵϬϳ Ϭ͘ϭϲϱϴϯϰ Ϭ͘ϭϳϵϱϯϮ Ϭ͘Ϭϲϴϭϲϯ Ϭ͘ϬϰϬϬϰϮ Ϭ͘Ϭϭϵϱϵϵ Ϭ͘ϬϬϬϰϰϬϴϴ Ϭ͘Ϭϯϭϭϱϵ Ϭ͘ϬϭϭϬϮϴϯϴϵ Ϯ͘ϴϴϰϭϬϯ Ϭ͘ϬϱϮϭϯϭ ϭϰ͘ϮϬϳϮϮZK'ͺ,d^<Ϭ͘Ϭϲϯϵϳϭ Ϭ͘Ϭϵϳϯϰ Ϭ͘ϬϰϳϳϬϭ Ϭ͘ϬϱϬϬϰϰ Ϭ͘Ϭϭϳϲϯ Ϭ͘ϬϬϵϴϴϲ Ϭ͘ϬϬϰϳϵϯ Ϭ͘ϬϬϬϭϮϴϱϲϵ Ϭ͘ϬϬϳϮϬϲ Ϭ͘ϬϬϯϯϯϭϲϬϯ ϯ͘ϱϰϭϬϮϭ Ϭ͘Ϭϭϭϴϰϭ ϯ͘ϳϳϳϴϴZK'ͺ/>yϬϬϬϬϬ͘ϬϭϴϬϭϮ Ϭ͘Ϭϭϯϱϭ Ϭ͘ϬϮϰϴϮϰ Ϭ͘Ϯϳϴϲϱϱϴϳ Ϭ͘ϬϯϮϳϲϰ Ϭ Ϭ Ϭ͘ϯϭϮϮϲϭ ϬZK'ͺZ^d>ϬϬϬϬϬϬϬ ϬϬ ϬϬϬϬZK'ͺZhEyϬ͘ϬϬϰϱϯϴ Ϭ͘Ϭϭϭϴϲϱ Ϭ͘ϬϬϱϳϰϮ Ϭ͘ϬϬϲϭϬϱ Ϭ͘ϬϰϰϭϱϮ Ϭ͘ϬϳϮϲϮ Ϭ͘ϬϮϭϱϬϯ Ϭ͘ϬϮϲϬϭϬϲϴϭ Ϭ͘Ϭϭϵϭϴϭ Ϭ͘ϬϰϴϭϯϬϯϬϮ Ϭ͘ϴϭϴϳϳϭ Ϭ͘ϬϱϲϬϳϳ Ϭ͘ϬϰϰϭϵϲZK'ͺZhE>^Ϭ͘ϭϳϮϰϮϴ Ϭ͘Ϯϳϱϯϰϳ Ϭ͘ϭϮϲϳϳϭ Ϭ͘ϭϯϳϲϲ Ϭ͘ϭϬϬϰϲϮ Ϭ͘Ϭϱϲϲ Ϭ͘ϬϰϬϮϳϮ Ϭ͘ϬϬϬϵϯϬϱϰϬ͘Ϭϯϲϭϯϴ Ϭ͘ϬϭϮϲϬϯϰϰϵ ϯ͘ϲϴϳϱϲϱ Ϭ͘Ϭϯϳϲϵϰ Ϭ͘ϬϵϭϱϭϱZK'ͺ^dZyϬ͘ϮϮϭϰϯϰ Ϭ͘ϯϭϲϳϳϮ Ϭ͘ϮϰϰϵϬϮ Ϭ͘Ϯϲϴϯϰϯ Ϭ͘ϬϳϳϵϮϵ Ϭ͘ϬϰϬϰϰϵ Ϭ͘ϬϱϬϯϲϱ Ϯ͘ϮϲϭϲϳͲϬϲ Ϭ͘Ϭϰϰϵϯϲ Ϭ͘ϬϭϲϮϰϲϰϭϰ ϭ͘Ϭϴϳϯϵ Ϭ͘Ϭϱϭϯϲϰ Ϭ͘Ϭϴϳϴϳϲ^KϮͺ/>yϬϬϬϬϳ͘ϲϰͲϬϱϬ͘ϬϬϬϭϮϰ Ϭ͘ϬϬϭϮϳϴ Ϭ͘ϬϬϱϵϯϬϮϱϯ Ϭ͘ϬϬϬϴϰϲ Ϭ Ϭ Ϭ͘ϬϬϭϴϲϳ Ϭ^KϮͺZhEyϬ͘ϬϬϮϭϳϴ Ϭ͘ϬϬϮϴϱ Ϭ͘ϬϬϮϴϴϲ Ϭ͘ϬϬϯϰϯϳ Ϭ͘ϬϬϲϳϰϭ Ϭ͘ϬϬϳϬϬϵ Ϭ͘ϬϭϭϮϮϳ Ϭ͘Ϭϭϯϵϵϯϯϲϱ Ϭ͘Ϭϭϭϳϭϱ Ϭ͘ϬϬϳϵϱϱϰϬϮ Ϭ͘ϬϬϭϴϯϰ Ϭ͘ϬϬϴϰϵϯ Ϭ͘ϬϭϲϮϳϰ^KϮͺ^dZyϬ͘ϬϬϬϱϲϴ Ϭ͘ϬϬϬϳϯϰ Ϭ͘ϬϬϬϳϯ Ϭ͘ϬϬϬϴϲϰ Ϭ͘ϬϬϬϭϳϯ ϴ͘ϵϲͲϬϱ ϵ͘ϴϴͲϬϱ Ϯ͘ϯϳϭϰϱͲϬϲ ϴ͘ϭϵͲϬϱ ϱ͘ϮϱϰϴϰͲϬϱ Ϭ͘ϬϬϬϰϬϴ ϲ͘ϯϱͲϬϱ Ϭ͘ϬϬϬϮϬϮdK'ͺ/hZEϬ͘ϮϮϭϵϱ Ϭ͘ϯϰϴϵϬϳ Ϭ͘ϭϲϱϴϯϰ Ϭ͘ϭϳϵϱϯϮ Ϭ͘Ϭϲϴϭϲϯ Ϭ͘ϬϰϬϬϰϮ Ϭ͘Ϭϭϵϱϵϵ Ϭ͘ϬϬϬϰϰϬϴϴ Ϭ͘Ϭϯϭϭϱϵ Ϭ͘ϬϭϭϬϮϴϯϴϵ Ϭ͘ϬϳϬϮϱϵ Ϭ͘ϬϱϮϭϯϭ ϭϰ͘ϮϬϳϮϮdK'ͺ,d^<Ϭ͘Ϭϲϯϵϳϭ Ϭ͘Ϭϵϳϯϰ Ϭ͘ϬϰϳϳϬϭ Ϭ͘ϬϱϬϬϰϰ Ϭ͘Ϭϭϳϲϯ Ϭ͘ϬϬϵϴϴϲ Ϭ͘ϬϬϰϳϵϯ Ϭ͘ϬϬϬϭϮϴϱϲϵ Ϭ͘ϬϬϳϮϬϲ Ϭ͘ϬϬϯϯϯϭϲϬϯ ϯ͘ϱϰϭϬϮϭ Ϭ͘Ϭϭϭϴϰϭ ϯ͘ϳϳϳϴϴdK'ͺ/>yϬϬϬϬϬ͘ϬϮϱϰϴϳ Ϭ͘ϬϭϳϵϱϮ Ϭ͘Ϭϰϰϭϲϴ Ϭ͘ϱϱϬϬϰϬϴϴϲ Ϭ͘Ϭϰϯϲϯ Ϭ Ϭ Ϭ͘ϰϴϴϳϳϰ ϬdK'ͺZ^d>ϬϬϬϬϬϬϬ ϬϬ ϬϬϬϬdK'ͺZhEyϬ͘ϬϬϲϲϭϱ Ϭ͘ϬϭϳϯϭϮ Ϭ͘ϬϬϴϯϲϱ Ϭ͘ϬϬϴϴϴϯ Ϭ͘ϬϱϯϰϭϮ Ϭ͘Ϭϴϯϳϰϵ Ϭ͘ϬϯϰϮϴϳ Ϭ͘ϮϰϬϭϲϬϬϳϵ Ϭ͘ϬϯϬϱϯϳ Ϭ͘ϲϱϭϭϳϭϰϯϵ ϭ͘ϬϬϲϴϲϳ Ϭ͘ϭϰϮϰϲϮ Ϭ͘ϬϱϱϲϮϭdK'ͺZhE>^Ϭ͘ϭϳϮϰϮϴ Ϭ͘Ϯϳϱϯϰϳ Ϭ͘ϭϮϲϳϳϭ Ϭ͘ϭϯϳϲϲ Ϭ͘ϭϬϬϰϲϮ Ϭ͘Ϭϱϲϲ Ϭ͘ϬϰϬϮϳϮ Ϭ͘ϬϬϬϵϯϬϱϰϬ͘Ϭϯϲϭϯϴ Ϭ͘ϬϭϮϲϬϯϰϰϵ ϯ͘ϲϴϳϱϲϱ Ϭ͘Ϭϯϳϲϵϰ Ϭ͘ϬϵϭϱϭϱdK'ͺ^dZyϬ͘ϮϰϮϰϰϮ Ϭ͘ϯϰϲϴϮϲ Ϭ͘Ϯϲϴϭϯϳ Ϭ͘ϮϵϯϴϬϮ Ϭ͘ϬϴϱϯϮϮ Ϭ͘ϬϰϰϮϴϲ Ϭ͘Ϭϱϱϭϰϯ Ϯ͘ϰϳϲϮϰͲϬϲ Ϭ͘Ϭϰϵϭϵϵ Ϭ͘Ϭϭϳϳϴϳϳϳϵ ϭ͘ϭϴϯϬϰϯ Ϭ͘ϬϱϲϮϯϳ Ϭ͘ϬϵϲϮϭϯEϮKͺ/>y ϬϬϬϬϬ͘ϬϬϬϱϱϮ Ϭ͘ϬϬϭϱϴϴ Ϭ͘ϬϮϭϭϲϭ Ϭ͘ϭϭϴϳϲϱϵϳϱ Ϭ͘Ϭϭϯϰϴϴ Ϭ Ϭ Ϭ͘ϬϮϯϴϵϰ Ϭ EϮKͺZhEy Ϭ͘ϬϬϯϬϵϰ Ϭ͘ϬϬϱϮϱϵ Ϭ͘ϬϬϯϴϴϯ Ϭ͘ϬϬϰϰϲ Ϭ͘Ϭϯϯϳϵϴ Ϭ͘ϬϳϯϵϮϵ Ϭ͘ϭϯϱϳϯϭ Ϭ͘ϮϲϬϮϲϰϰϬϴ Ϭ͘ϭϲϮϮϮϰ Ϭ͘ϭϱϭϮϯϱϳϬϱ Ϭ͘Ϭϯϱϰϰϲ Ϭ͘Ϭϵϵϭϳϱ Ϭ͘ϬϲϳϬϳϭ EϮKͺ^dZy Ϭ͘ϬϮϰϵϲϳ Ϭ͘ϬϯϬϭϰϲ Ϭ͘ϬϮϵϬϴϳ Ϭ͘ϬϮϵϰϳϳ Ϭ͘ϬϮϴϳϮϳ Ϭ͘Ϭϭϰϵϯϱ Ϭ͘ϬϬϳϰϵϰ Ϯ͘ϯϯϳϭϲͲϬϳ Ϭ͘ϬϬϴϱϮϵ Ϭ͘ϬϬϳϭϴϵϰϬϱ Ϭ͘ϬϬϲϬϴϰ Ϭ͘ϬϬϲϭϲϱ Ϭ͘ϬϮϵϲϲϴĂůDŽĚD&ϮϬϮϭŵŝƐƐŝŽŶ&ĂĐƚŽƌƐ/ŶƉƵƚ zĞĂƌ ϮϬϮϴ&ůĞĞƚDŝǆ>ĂŶĚhƐĞ^ƵďdǇƉĞ > >dϭ >dϮ Ds >,ϭ >,Ϯ D, ,, Kh^ hh^ Dz ^h^ D,ŶĐůŽƐĞĚWĂƌŬŝŶŐǁŝƚŚůĞǀĂƚŽƌϬ͘ϰϭϭϳϱϳ Ϭ͘Ϭϰϭϰϯϲ Ϭ͘ϮϵϳϱϮϲ Ϭ͘ϭϳϬϵϴϲ Ϭ͘ϬϯϬϲϮϰ Ϭ͘ϬϬϳϬϮϯ Ϭ͘ϬϬϴϰϮ Ϭ͘ϬϬϮϰϯϲϬ͘ϬϬϮϮϰϲ Ϭ͘ϬϬϬϲϳϵ Ϭ͘ϬϮϰϯϲϭ Ϭ͘ϬϬϬϰϬϮ Ϭ͘ϬϬϮϭϬϰZĞƐĞĂƌĐŚΘĞǀĞůŽƉŵĞŶƚϬ͘ϰϭϭϳϱϳ Ϭ͘Ϭϰϭϰϯϲ Ϭ͘ϮϵϳϱϮϲ Ϭ͘ϭϳϬϵϴϲ Ϭ͘ϬϯϬϲϮϰ Ϭ͘ϬϬϳϬϮϯ Ϭ͘ϬϬϴϰϮ Ϭ͘ϬϬϮϰϯϲϬ͘ϬϬϮϮϰϲ Ϭ͘ϬϬϬϲϳϵ Ϭ͘ϬϮϰϯϲϭ Ϭ͘ϬϬϬϰϬϮ Ϭ͘ϬϬϮϭϬϰĂůDŽĚD&ϮϬϮϭ&ůĞĞƚDŝǆ/ŶƉƵƚ $WWDFKPHQW 3URMHFW&RQVWUXFWLRQ(PLVVLRQVDQG+HDOWK5LVN &DOFXODWLRQV 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$ '30&RQVWUXFWLRQ(PLVVLRQVDQG0RGHOLQJ(PLVVLRQ5DWHV8QPLWLJDWHG (PLVV LRQV SHU &RQVWUXFWLRQ '30 6RXUFH 1R '30(PLVVLRQV 3RLQW6RXUFH <HDU $FWLYLW\ WRQ\HDU 7\SH 6RXUFHV OE\U OEKU JV JV 2023 &RQVWUXFWLRQ 3RLQW ( ( 2024 &RQVWUXFWLRQ 3RLQW ( ( 2025 &RQVWUXFWLRQ 3RLQW ( ( 2026 &RQVWUXFWLRQ 3RLQW ( ( 2027 &RQVWUXFWLRQ 3RLQW ( ( Total 0.3484 696.9 0.2246 0.0283 (PLVVLRQVDVVXPHGWREHHYHQO\GLVWULEXWHGRYHUHDFKFRQVWUXFWLRQDUHDV KUGD\ DPSP GD\V\U KRXUV\HDU 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$ 30)XJLWLYH'XVW(PLVVLRQVIRU0RGHOLQJ8QPLWLJDWHG 30 0RGHOHG (PLVVLRQ &RQVWUXFWLRQ $UHD 30(PLVVLRQV $UHD 5DWH <HDU $FWLYLW\ 6RXUFH WRQ\HDU OE\U OEKU JV P JVP 2023 &RQVWUXFWLRQ &21B)8* ( ( 2024 &RQVWUXFWLRQ &21B)8* ( ( 2025 &RQVWUXFWLRQ &21B)8* ( ( 2026 &RQVWUXFWLRQ &21B)8* ( ( 2027 &RQVWUXFWLRQ &21B)8* ( ( Total 0.4316 863.3 0.2783 0.0351 Construction Hours KUGD\ DPSP GD\V\U KRXUV\HDU '30&RQVWUXFWLRQ(PLVVLRQVDQG0RGHOLQJ(PLVVLRQ5DWHV:LWK0 LWLJDWLRQ (PLVV LRQV SHU &RQVWUXFWLRQ '30 6RXUFH 1R '30(PLVVLRQV 3RLQW6RXUFH <HDU $FWLYLW\ WRQ\HDU 7\SH 6RXUFHV OE\U OEKU JV JV 2023 &RQVWUXFWLRQ 3RLQW ( ( 2024 &RQVWUXFWLRQ 3RLQW ( ( 2025 &RQVWUXFWLRQ 3RLQW ( ( 2026 &RQVWUXFWLRQ 3RLQW ( ( 2027 &RQVWUXFWLRQ 3RLQW ( ( Total 0.1026 205.1 0.0661 0.0083 (PLVVLRQVDVVXPHGWREHHYHQO\GLVWULEXWHGRYHUHDFKFRQVWUXFWLRQDUHDV KUGD\ DPSP GD\V\U KRXUV\HDU 30)XJLWLYH'XVW&RQVWUXFWLRQ(PLVVLRQVIRU0RGHOLQJ:LWK0LWLJDWLRQ 30 0RGHOHG (PLVVLRQ &RQVWUXFWLRQ $UHD 30(PLVVLRQV $UHD 5DWH <HDU $FWLYLW\ 6RXUFH WRQ\HDU OE\U OEKU JV P JVP 2023 &RQVWUXFWLRQ &21B)8* ( ( 2024 &RQVWUXFWLRQ &21B)8* ( ( 2025 &RQVWUXFWLRQ &21B)8* ( ( 2026 &RQVWUXFWLRQ &21B)8* ( ( 2027 &RQVWUXFWLRQ &21B)8* ( ( Total 0.2087 417.4 0.1345 0.0170 Construction Hours KUGD\ DPSP GD\V\U KRXUV\HDU 'XEXTXH$YHQXH6RXWK6DQ)UDQFLVFR&$ &RQVWUXFWLRQ+HDOWK,PSDFW6XPPDU\ 0D[LPXP,PSDFWVDW0(,/RFDWLRQ:LWKRXW0LWLJDWLRQ 0D[LPXP&RQFHQWUDWLRQV 0D[LPXP ([KDXVW )XJLWLYH +D]DUG $QQXDO30 (PLVVLRQV 30'30 30 ,QGH[ &RQFHQWUDWLRQ <HDU ȝJP ȝJP ,QIDQW&KLOG ȝJP 7RWDO 0D[LPXP 0D[LPXP,PSDFWVDW0(,/RFDWLRQ:LWK0LWLJDWLRQ 0D[LPXP&RQFHQWUDWLRQV 0D[LPXP ([KDXVW )XJLWLYH +D]DUG $QQXDO30 (PLVVLRQV 30'30 30 ,QGH[ &RQFHQWUDWLRQ <HDU ȝJP ȝJP ,QIDQW&KLOG ȝJP 7RWDO 0D[LPXP (OHFWULILHGGHZDWHULQJSXPSVOLIWVFRPSUHVVRUVFUDQHVZHOGHUVIRUNOLIWVDQGKRLVWVDOVRLQFOXGHGDV0LWLJDWLRQ0HDVXUHV 7LHULQWHULPHQJLQHVDQG%03VDV0LWLJDWLRQ0HDVXUHV &DQFHU5LVN SHUPLOOLRQ &DQFHU5LVN SHUPLOOLRQ 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$&RQVWUXFWLRQ,PSDFWV :LWKRXW0LWLJDWLRQ 0D[LPXP'30&DQFHU5LVNDQG30&DOFXODWLRQV)URP&RQVWUXFWLRQ ,PSDFWVDW*DWHZD\&KLOG'HYHORSPHQW&HQWHU<0&$PHWHU,QIDQW([SRVXUH 6WXGHQW&DQFHU5LVNSHUPLOOLRQ &3)[,QKDODWLRQ'RVH[$6)[('$7[( :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV ,QKDODWLRQ'RVH &DLU[6&$)[+U%5[$[()[ :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP 6&$) 6FKRRO&KLOG$GMXVWPHQW)DFWRUXQLWOHVVIRUVRXUFHRS HUDWLRQ DQGH[SRVXUHVGLIIHUHQWWKDQKRXUVGD\ 6+5[GD\V6'D\[6&+5KUV 6+5 +RXUVGD\RIHPLVVLRQVRXUFHRSHUDWLRQ 6'D\ 1XPEHURIGD\VSHUZHHNRIVRXUFHRSHUDWLRQ 6&+5 6FKRRORSHUDWLRQKRXUVZKLOHHPLVVLRQVRXUFHLQRSHUDWLRQ +U%5 (LJKWKRXUEUHDWKLQJUDWH/NJERG\ZHLJKWSHUKUV $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU 9DOXHV ,QIDQW &KLOG $JH! 3DUDPHWHU $6) '30&3) ( ( +U%5 6&+5 6+5 6'D\ $ () $7 6&$) WKSHUFHQWLOHKUEUHDWKLQJUDWHVIRUPRGHUDWHLQWHQVLW\DFWLYLWLHV &RQVWUXFWLRQ&DQFHU5LVNE\<HDU0D[LPXP3UHVFKRRO,PSDFW5HFHSWRU/RFDWLRQ &KLOG([SRVXUH,QIRUPDWLRQ &KLOG ([SRVXUH $JH &DQFHU 0D[LPXP ([SRVXUH 'XUDWLRQ '30&RQFXJP 6HQVLWLYLW\ 5LVN +D]DUG )XJLWLYH 7RWDO <HDU \HDUV $JH <HDU $QQXDO )DFWRU SHUPLOOLRQ ,QGH[ 30 30 7RWDO,QFUHDVHG&DQFHU5LVN &KLOGUHQDVVXPHGWREHPRQWKVRIDJHZLWK\HDUVRIH[SRVXUHWRFRQVWUXFWLRQHPLVVLRQV 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$&RQVWUXFWLRQ,PSDFWV :LWK0LWLJDWLRQ 0D[LPXP'30&DQFHU5LVNDQG30&DOFXODWLRQV)URP&RQVWUXFWLRQ ,PSDFWVDW*DWHZD\&KLOG'HYHORSPHQW&HQWHU<0&$PHWHU,QIDQW([SRVXUH 6WXGHQW&DQFHU5LVNSHUPLOOLRQ &3)[,QKDODWLRQ'RVH[$6)[('$7[( :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV ,QKDODWLRQ'RVH &DLU[6&$)[+U%5[$[()[ :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP 6&$) 6FKRRO&KLOG$GMXVWPHQW)DFWRUXQLWOHVVIRUVRXUFHRS HUDWLRQ DQGH[SRVXUHVGLIIHUHQWWKDQKRXUVGD\ 6+5[GD\V6'D\[6&+5KUV 6+5 +RXUVGD\RIHPLVVLRQVRXUFHRSHUDWLRQ 6'D\ 1XPEHURIGD\VSHUZHHNRIVRXUFHRSHUDWLRQ 6&+5 6FKRRORSHUDWLRQKRXUVZKLOHHPLVVLRQVRXUFHLQRSHUDWLRQ +U%5 (LJKWKRXUEUHDWKLQJUDWH/NJERG\ZHLJKWSHUKUV $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU 9DOXHV ,QIDQW &KLOG $JH! 3DUDPHWHU $6) '30&3) ( ( +U%5 6&+5 6+5 6'D\ $ () $7 6&$) WKSHUFHQWLOHKUEUHDWKLQJUDWHVIRUPRGHUDWHLQWHQVLW\DFWLYLWLHV &RQVWUXFWLRQ&DQFHU5LVNE\<HDU0D[LPXP3UHVFKRRO,PSDFW5HFHSWRU/RFDWLRQ &KLOG([SRVXUH,QIRUPDWLRQ &KLOG ([SRVXUH $JH &DQFHU 0D[LPXP ([SRVXUH 'XUDWLRQ '30&RQFXJP 6HQVLWLYLW\ 5LVN +D]DUG )XJLWLYH 7RWDO <HDU \HDUV $JH <HDU $QQXDO )DFWRU SHUPLOOLRQ ,QGH[ 30 30 7RWDO,QFUHDVHG&DQFHU5LVN &KLOGUHQDVVXPHGWREHPRQWKVRIDJHZLWK\HDUVRIH[SRVXUHWRFRQVWUXFWLRQHPLVVLRQV $WWDFKPHQW &RPPXQLW\5LVN0RGHOLQJ,QIRUPDWLRQDQG&DOFXODWLRQV ϴϬϬƵďƵƋƵĞǀĞŶƵĞ͕^ŽƵƚŚ^ĂŶ&ƌĂŶĐŝƐĐŽ͕ ^ƚĂŶĚďǇŵĞƌŐĞŶĐǇ'ĞŶĞƌĂƚŽƌ/ŵƉĂĐƚƐ KĨĨͲƐŝƚĞ^ĞŶƐŝƚŝǀĞZĞĐĞƉƚŽƌƐ D/>ŽĐĂƚŝŽŶсϭŵĞƚĞƌƌĞĐĞƉƚŽƌŚĞŝŐŚƚ WDŵŝƐƐŝŽŶƐƉĞƌ'ĞŶĞƌĂƚŽƌ DĂǆĂŝůǇ ŶŶƵĂů ^ŽƵƌĐĞdǇƉĞ ;ůďͬĚĂǇͿ ;ůďͬǇĞĂƌͿ ;ϯͿϮ͕ϴϬϬŬǁ͕;ϮͿϭ͕ϬϬϬŬǁ͕;ϭͿϲϬϬŬǁ 'ĞŶĞƌĂƚŽƌϬ͘Ϭϴϴ ϯϮ͘ϮϬ ĂůDŽĚWDŵŝƐƐŝŽŶƐ ϭ͘ϲϭͲϬϮ ƚŽŶƐͬǇĞĂƌ DŽĚĞů ZDK ^ŽƵƌĐĞ ŝĞƐĞů'ĞŶĞƌĂƚŽƌŶŐŝŶĞ ^ŽƵƌĐĞdǇƉĞ WŽŝŶƚ DĞƚĞŽƌŽůŽŐŝĐĂůĂƚĂ ϮϬϭϯͲϮϬϭϳ^ĂŶ&ƌĂŶĐŝƐĐŽ/ŶƚĞƌŶĂƚŝŽŶĂůDĞƚĞŽƌŽůŽŐŝĐĂůĂƚĂ 'ĞŶĞƌĂƚŽƌŶŐŝŶĞ^ŝǌĞ;ŚƉͿ ϯϳϱϯ͕ϭϯϰϭ͕ΘϴϬϰ ^ƚĂĐŬ,ĞŝŐŚƚ;ĨƚͿ ϭϬ͘ϬϬ ^ƚĂĐŬŝĂŵĞƚĞƌ;ĨƚͿΎΎ Ϭ͘ϲϬ ǆŚĂƵƐƚ'ĂƐ&ůŽǁƌĂƚĞ;&DͿΎ ϮϱϮϳ͘ϳϯ ^ƚĂĐŬǆŝƚsĞůŽĐŝƚǇ;ĨƚͬƐĞĐͿΎΎ ϭϰϵ͘ϬϬ ǆŚĂƵƐƚdĞŵƉĞƌĂƚƵƌĞ;ȗ&ͿΎΎ ϴϳϮ͘ϬϬ ŵŝƐƐŝŽŶƐZĂƚĞ;ůďͬŚƌͿ Ϭ͘ϬϬϯϲϳϲ ΎZDKĚĞĨĂƵůƚ ΎΎYDĚĞĨĂƵůƚŐĞŶĞƌĂƚŽƌƉĂƌĂŵĞƚĞƌƐ WDŵŝƐƐŝŽŶZĂƚĞƐ DŽĚĞůŝŶŐ/ŶĨŽƌŵĂƚŝŽŶ WŽŝŶƚ^ŽƵƌĐĞ^ƚĂĐŬWĂƌĂŵĞƚĞƌƐ 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$&DQFHU5LVNVIURP3URMHFW2SHUDWLRQ 3URMHFW(PHUJHQF\*HQHUDWRUV ,PSDFWVDW2II6LWH*DWHZD\&KLOG'HYHORSPHQW&HQWHU<0&$P0(,5HFHSWRU+HLJKWV ,PSDFWDW3URMHFW0(,\HDU([SRVXUH &DQFHU5LVNSHUPLOOLRQ &3)[,QKDODWLRQ'RVH[$6)[('$7[)$+[( :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV )$+ )UDFWLRQRIWLPHVSHQWDWKRPHXQLWOHVV ,QKDODWLRQ'RVH &DLU['%5[$[()[ :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP 6$) 6WXGHQW$GMXVWPHQW)DFWRUXQLWOHVV KUVKUV[GD\VGD\V +U%5 (LJKWKRXUEUHDWKLQJUDWH/NJERG\ZHLJKWSHUKUV $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU ,QIDQW&KLOG $GXOW $JH! UG7ULPHVWHU 3DUDPHWHU $6) &3) ( ( ( ( '%5 $ () $7 )$+ ΎWKSHUFHQWLOHKUEUHDWKLQJUDWHVIRUPRGHUDWHLQWHQVLW\DFWLYLWLHV &RQVWUXFWLRQ&DQFHU5LVNE\<HDU0D[LPXP,PSDFW5HFHSWRU/RFDWLRQ ,QIDQW&KLOG([SRVXUH,QIRUPDWLRQ ,QIDQW&KLOG ([SRVXUH $JH &DQFHU ([SRVXUH 'XUDWLRQ '30&RQFXJP 6HQVLWLYLW\ 5LVN +D]DUG )XJLWLYH 7RWDO <HDU \HDUV $JH <HDU $QQXDO )DFWRU SHUPLOOLRQ ,QGH[ 30 30 7RWDO,QFUHDVHG&DQFHU5LVN 0D[ (YDSRUDWLYH&RROLQJ7RZHU30(PLVVLRQV 7RWDO:DWHU)ORZ5DWHJSP &RROLQJ7RZHU&LUFXODWLQJ:DWHU7'6SSP 0LVW(OLPLQDWRU(IILFLHQF\ 7RWDO&RROLQJ7RZHU'ULIWJSP 3DUWLFXODWH0DWWHU(PLVVLRQV 30 30 30 )UDFWLRQRI30 +RXUO\OEKU ( ( ( 'DLO\OEGD\ $QQXDOOE\U $QQXDOWRQ\U 0D[LPXP7'6YDOXHEDVHGRQ6RXWK6DQ)UDQFLVFR:DWHU4XD OLW\5HSRUW 6RXWK&RDVW$40')LQDO0HWKRGRORJ\WR&DOFXODWH3DUWLFXODWH 0DWWHU30DQG306LJQLILFDQFH7KUHVKROGV$SSHQGL[$ 'XEXTXH$YHQXH6RXWK6DQ)UDQFLVFR&$3URMHFW&RROLQJ7RZHU30 $(502'5LVN0RGHOLQJ3DUDPHWHUVDQG0D[LPXP&RQFHQWUDWLRQV3URMHFW&RROLQJ7RZHU DW*DWHZD\&KLOG'HYHORSPHQW&HQWHU<0&$0(,5HFHSWRUPUHFH SWRUKHLJKW (PLV V LRQ<HDU 5HFHSWRU,QIRUPDWLRQ &KLOGFDUH0(,UHFHSWRU 1XPEHURI5HFHSWRUV 5HFHSWRU+HLJKW PHWHU 5HFHSWRU'LVWDQFHV $W&KLOGFDUH0(,ORFDWLRQ 0HWHRURORJLFDO&RQGLWLRQV %$40'6DQ)UDQFLVFR,QWHUQDWLRQDO$LUS /DQG8VH&ODVVLILFDWLRQ 8UEDQ :LQG6SHHG 9DULDEOH :LQG'LUHFWLRQ 9DULDEOH 300D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV 30&RQFHQWUDWLRQȝJP 3UHVFKRRO0(, 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ+LJKZD\ '300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG'30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ '30B1%B +LJKZD\1RUWKERXQG 1% '30B6%B +LJKZD\6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG'30(PLVVLRQV'30B1%B +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG'30(PLVVLRQV'30B6%B +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ+LJKZD\ 300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG30(PLV VLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQ JWK P /LQN /HQJ WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJH 6SHHG PSK $YHUDJ H 9HKLFOHV SHU'D\ 30B1%B +LJKZD\1RUWKERXQG 1% 30B6%B +LJKZD\6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG30(PLVVLRQV30B1%B +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG30(PLVVLRQV30B6%B +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ+LJKZD\ 72*([KDXVW0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(;+B1%B$,5 +LJKZD\ 1RUWKERXQG 1% 7(;+B6%B$,5 +LJKZD\ 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV72*([KDXVW 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV7(;+B1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*([KDXVW(PLVV LRQV7(;+B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ+LJKZD\ 72*(YDSRUDWLYH(PLVVLRQV0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(9$3B1%B$,5 +LJKZD\1RUWKERXQG 1% 7(9$3B6%B$,5 +LJKZD\6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30(YDSRUDWLYH72* 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHSHU+RXUJKRXU (PLVVLRQVSHU9HKLFOHSHU0LOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ+LJKZD\ )XJLWLYH5RDG300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG)XJLWLYH5RDG30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQ J WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJ H 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ )8*B1%B$,5 +LJKZD\1RUWKERXQG 1% )8*B6%B$,5 +LJKZD\6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV)XJLWLYH30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK 7LUH:HDU(PLVVLRQVSHU9HKLFOHJ907 %UDNH:HDU(PLVVLRQVSHU9HKLFOHJ907 5RDG'XVW(PLVVLRQVSHU9HKLFOHJ907 RWDO)XJ LWLYH30(PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG)XJLWLYH30(PLVVLRQV)8*B 1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG)XJLWLYH30(PLVVLRQV)8*B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ$LUSRUW%OYG '300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG'30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ '30B1%B$,5 $LUSRUW%OYG1RUWKERXQG 1% '30B6%B$,5 $LUSRUW%OYG6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG'30(PLVVLRQV'30B1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG'30(PLVVLRQV'30B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ$LUSRUW%OYG 300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQ JWK P /LQN /HQJ WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJH 6SHHG PSK $YHUDJ H 9HKLFOHV SHU'D\ 30B1%B$,5 $LUSRUW%OYG1RUWKERXQG 1% 30B6%B$,5 $LUSRUW%OYG6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG30(PLVVLRQV30B1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG30(PLVVLRQV30B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ$LUSRUW%OYG 72*([KDXVW0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(;+B1%B$,5 $LUSRUW%OYG1RUWKERXQG 1% 7(;+B6%B$,5 $LUSRUW%OYG 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV72*([KDXVW 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV7(;+B1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*([KDXVW(PLVV LRQV7(;+B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ$LUSRUW%OYG 72*(YDSRUDWLYH(PLVVLRQV0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(9$3B1%B$,5 $LUSRUW%OYG1RUWKERXQG 1% 7(9$3B6%B$,5 $LUSRUW%OYG6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30(YDSRUDWLYH72* 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHSHU+RXUJKRXU (PLVVLRQVSHU9HKLFOHSHU0LOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ$LUSRUW%OYG )XJLWLYH5RDG300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG)XJLWLYH5RDG30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQ J WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJ H 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ )8*B1%B$,5 $LUSRUW%OYG1RUWKERXQG 1% )8*B6%B$,5 $LUSRUW%OYG6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV)XJLWLYH30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK 7LUH:HDU(PLVVLRQVSHU9HKLFOHJ907 %UDNH:HDU(PLVVLRQVSHU9HKLFOHJ907 5RDG'XVW(PLVVLRQVSHU9HKLFOHJ907 RWDO)XJ LWLYH30(PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG)XJLWLYH30(PLVVLRQV)8*B 1%B$,5 +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG)XJLWLYH30(PLVVLRQV)8*B6%B$,5 +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ'XEXTXH$YH '300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG'30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ '30B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% '30B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG'30(PLVVLRQV'30B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG'30(PLVVLRQV'30B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ'XEXTXH$YH 300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQ JWK P /LQN /HQJ WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJH 6SHHG PSK $YHUDJ H 9HKLFOHV SHU'D\ 30B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% 30B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG30(PLVVLRQV30B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG30(PLVVLRQV30B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ'XEXTXH$YH 72*([KDXVW0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(;+B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% 7(;+B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV72*([KDXVW 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV7(;+B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*([KDXVW(PLVV LRQV7(;+B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ'XEXTXH$YH 72*(YDSRUDWLYH(PLVVLRQV0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(9$3B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% 7(9$3B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30(YDSRUDWLYH72* 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHSHU+RXUJKRXU (PLVVLRQVSHU9HKLFOHSHU0LOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO &XPXODWLYH2SHUDWLRQ'XEXTXH$YH )XJLWLYH5RDG300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG)XJLWLYH5RDG30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQ J WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJ H 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ )8*B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% )8*B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV)XJLWLYH30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK 7LUH:HDU(PLVVLRQVSHU9HKLFOHJ907 %UDNH:HDU(PLVVLRQVSHU9HKLFOHJ907 5RDG'XVW(PLVVLRQVSHU9HKLFOHJ907 RWDO)XJ LWLYH30(PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG)XJLWLYH30(PLVVLRQV)8*B 1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG)XJLWLYH30(PLVVLRQV)8*B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$+LJKZD\7UDIILF7$&V 30 $(502'5LVN0RGHOLQJ3DUDPHWHUVDQG0D[LPXP&RQFHQWUDWLRQV DW&RQVWUXFWLRQ5HVLGHQWLDO0(,5HFHSWRUV/RFDWLRQPHWHUUHFHSWRUKHLJKW (PLVVLRQ<HDU 5HFHSWRU,QIRUPDWLRQ &RQVWUXFWLRQ6FKRRO0(,UHFHSWRU 1XPEHURI5HFHSWRUV 5HFHSWRU+HLJKW 0HWHU 5HFHSWRU'LVWDQFHV $W&RQVWUXFWLRQ6FKRRO0(,ORFDWLRQ 0HWHRURORJLFDO&RQGLWLRQV %$$40'6DQ)UDQFLVFR,QWHUQDWLRQDO$LUSRUW0 /DQG8VH&ODVVLILFDWLRQ 8UEDQ :LQG6SHHG 9DULDEOH :LQG'LUHFWLRQ 9DULDEOH &RQVWUXFWLRQ6FKRRO0(,&DQFHU5LVN0D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV '30 ([KDXVW72* (YDSRUDWLYH72* &RQVWUXFWLRQ6FKRRO0(,300D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV 7RWDO30 )XJLWLYH30 9HKLFOH30 &RQFHQWUDWLRQȝJP 30&RQFHQWUDWLRQȝJP 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$$LUSRUW%OYG7UDIILF 7$&V 30 $(502'5LVN0RGHOLQJ3DUDPHWHUVDQG0D[LPXP&RQFHQWUDWLRQV DW&RQVWUXFWLRQ5HVLGHQWLDO0(,5HFHSWRUV/RFDWLRQPHWHUUHFHSWRUKHLJKW (PLVVLRQ<HDU 5HFHSWRU,QIRUPDWLRQ &RQVWUXFWLRQ6FKRRO0(,UHFHSWRU 1XPEHURI5HFHSWRUV 5HFHSWRU+HLJKW 0HWHU 5HFHSWRU'LVWDQFHV $W&RQVWUXFWLRQ6FKRRO0(,ORFDWLRQ 0HWHRURORJLFDO&RQGLWLRQV %$$40'6DQ)UDQFLVFR,QWHUQDWLRQDO$LUSRUW0 /DQG8VH&ODVVLILFDWLRQ 8UEDQ :LQG6SHHG 9DULDEOH :LQG'LUHFWLRQ 9DULDEOH &RQVWUXFWLRQ6FKRRO0(,&DQFHU5LVN0D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV '30 ([KDXVW72* (YDSRUDWLYH72* &RQVWUXFWLRQ6FKRRO0(,300D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV 7RWDO30 )XJLWLYH30 9HKLFOH30 &RQFHQWUDWLRQȝJP 30&RQFHQWUDWLRQȝJP 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$'XEXTXH$YHQXH7UDIILF7$&V 30 $(502'5LVN0RGHOLQJ3DUDPHWHUVDQG0D[LPXP&RQFHQWUDWLRQV DW&RQVWUXFWLRQ5HVLGHQWLDO0(,5HFHSWRUV/RFDWLRQPHWHUUHFHSWRUKHLJKW (PLVVLRQ<HDU 5HFHSWRU,QIRUPDWLRQ &RQVWUXFWLRQ6FKRRO0(,UHFHSWRU 1XPEHURI5HFHSWRUV 5HFHSWRU+HLJKW 0HWHU 5HFHSWRU'LVWDQFHV $W&RQVWUXFWLRQ6FKRRO0(,ORFDWLRQ 0HWHRURORJLFDO&RQGLWLRQV %$$40'6DQ)UDQFLVFR,QWHUQDWLRQDO$LUSRUW0 /DQG8VH&ODVVLILFDWLRQ 8UEDQ :LQG6SHHG 9DULDEOH :LQG'LUHFWLRQ 9DULDEOH &RQVWUXFWLRQ6FKRRO0(,&DQFHU5LVN0D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV '30 ([KDXVW72* (YDSRUDWLYH72* &RQVWUXFWLRQ6FKRRO0(,300D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV 7RWDO30 )XJLWLYH30 9HKLFOH30 &RQFHQWUDWLRQȝJP 30&RQFHQWUDWLRQȝJP 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$+LJKZD\7UDIILF&DQFHU5LVN ,PSDFWVDW&RQVWUXFWLRQ6FKRRO0(,PHWHUUHFHSWRUKHLJKW <HDU5HVLGHQWLDO([SRVXUH &DQFHU5LVN&DOFXODWLRQ0HWKRG &DQFHU5LVNSHUPLOOLRQ &3)[,QKDODWLRQ'RVH[$6)[('$7[)$+[( :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV )$+ )UDFWLRQRIWLPHVSHQWDWKRPHXQLWOHVV ,QKDODWLRQ'RVH &DLU['%5[$[()[ :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP '%5 GDLO\EUHDWKLQJUDWH/NJERG\ZHLJKWGD\ $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU &DQFHU3RWHQF\)DFWRUVPJNJGD\ &3) ( 9HKLFOH72*([KDXVW ( 9HKLFOH72*(YDSRUDWLYH ( 9DOXHV ,QIDQW&KLOG $GXOW $JH! UG7ULPHVWHU 3DUDPHWHU $6) '%5 $ () $7 )$+ WKSHUFHQWLOHEUHDWKLQJUDWHVIRULQIDQWVDQGWKSHUFHQWLOHIRUFKLOGUHQDQGDGXOWV &RQVWUXFWLRQ&DQFHU5LVNE\<HDU0D[LPXP,PSDFW5HFHSWRU/RFDWLRQ ([SRVXUH ([SRVXUH 'XUDWLRQ '30 ([KDXVW 72* (YDSRUDWLYH 72* '30 <HDU \HDUV $JH +D]DUG ,QGH[ )XJLWLYH 30 7RWDO 30 7RWDO,QFUHDVHG&DQFHU5LVN 7KLUGWULPHVWHURISUHJQDQF\ 7$& '30 0D[LPXP([SRVXUH,QIRUPDWLRQ 0D[LPXP 727$/ <HDU $JH 6HQVLWLYLW\ )DFWRU ([KDXV W 72* (YDSRUDWLYH 72* &RQFHQWUDWLRQXJP &DQFHU5LVNSHUPLOOLRQ 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$$LUSRUW%OYG7UDIILF&DQFHU5LVN ,PSDFWVDW&RQVWUXFWLRQ6FKRRO0(,PHWHUUHFHSWRUKHLJKW <HDU5HVLGHQWLDO([SRVXUH &DQFHU5LVN&DOFXODWLRQ0HWKRG &DQFHU5LVNSHUPLOOLRQ &3)[,QKDODWLRQ'RVH[$6)[('$7[)$+[( :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV )$+ )UDFWLRQRIWLPHVSHQWDWKRPHXQLWOHVV ,QKDODWLRQ'RVH &DLU['%5[$[()[ :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP '%5 GDLO\EUHDWKLQJUDWH/NJERG\ZHLJKWGD\ $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU &DQFHU3RWHQF\)DFWRUVPJNJGD\ &3) ( 9HKLFOH72*([KDXVW ( 9HKLFOH72*(YDSRUDWLYH ( 9DOXHV ,QIDQW&KLOG $GXOW $JH! UG7ULPHVWHU 3DUDPHWHU $6) '%5 $ () $7 )$+ WKSHUFHQWLOHEUHDWKLQJUDWHVIRULQIDQWVDQGWKSHUFHQWLOHIRUFKLOGUHQDQGDGXOWV &RQVWUXFWLRQ&DQFHU5LVNE\<HDU0D[LPXP,PSDFW5HFHSWRU/RFDWLRQ ([SRVXUH ([SRVXUH 'XUDWLRQ '30 ([KDXVW 72* (YDSRUDWLYH 72* '30 <HDU \HDUV $JH +D]DUG ,QGH[ )XJLWLYH 30 7RWDO 30 7RWDO,QFUHDVHG&DQFHU5LVN 7KLUGWULPHVWHURISUHJQDQF\ 0D[LPXP 727$/ <HDU $JH 6HQVLWLYLW\ )DFWRU ([KDXV W 72* (YDSRUDWLYH 72* &RQFHQWUDWLRQXJP &DQFHU5LVNSHUPLOOLRQ 7$& '30 0D[LPXP([SRVXUH,QIRUPDWLRQ 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$'XEXTXH$YHQXH7UDIILF&DQFHU5LVN ,PSDFWVDW&RQVWUXFWLRQ6FKRRO0(,PHWHUUHFHSWRUKHLJKW <HDU5HVLGHQWLDO([SRVXUH &DQFHU5LVN&DOFXODWLRQ0HWKRG &DQFHU5LVNSHUPLOOLRQ &3)[,QKDODWLRQ'RVH[$6)[('$7[)$+[( :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV )$+ )UDFWLRQRIWLPHVSHQWDWKRPHXQLWOHVV ,QKDODWLRQ'RVH &DLU['%5[$[()[ :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP '%5 GDLO\EUHDWKLQJUDWH/NJERG\ZHLJKWGD\ $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU &DQFHU3RWHQF\)DFWRUVPJNJGD\ &3) ( 9HKLFOH72*([KDXVW ( 9HKLFOH72*(YDSRUDWLYH ( 9DOXHV ,QIDQW&KLOG $GXOW $JH! UG7ULPHVWHU 3DUDPHWHU $6) '%5 $ () $7 )$+ WKSHUFHQWLOHEUHDWKLQJUDWHVIRULQIDQWVDQGWKSHUFHQWLOHIRUFKLOGUHQDQGDGXOWV &RQVWUXFWLRQ&DQFHU5LVNE\<HDU0D[LPXP,PSDFW5HFHSWRU/RFDWLRQ ([SRVXUH ([SRVXUH 'XUDWLRQ '30 ([KDXVW 72* (YDSRUDWLYH 72* '30 <HDU \HDUV $JH +D]DUG ,QGH[ )XJLWLYH 30 7RWDO 30 7RWDO,QFUHDVHG&DQFHU5LVN 7KLUGWULPHVWHURISUHJQDQF\ 7$& '30 0D[LPXP([SRVXUH,QIRUPDWLRQ &RQFHQWUDWLRQXJP &DQFHU5LVNSHUPLOOLRQ 0D[LPXP 727$/ <HDU $JH 6HQVLWLYLW\ )DFWRU ([KDXVW 72* (YDSRUDWLYH 72* 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO 3URMHFW7ULSV'XEXTXH$YH '300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG'30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ '30B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% '30B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG'30(PLVVLRQV'30B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG'30(PLVVLRQV'30B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO 3URMHFW7ULSV'XEXTXH$YH 300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQ JWK P /LQN /HQJ WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJH 6SHHG PSK $YHUDJ H 9HKLFOHV SHU'D\ 30B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% 30B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG30(PLVVLRQV30B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG30(PLVVLRQV30B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO 3URMHFW7ULSV'XEXTXH$YH 72*([KDXVW0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(;+B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% 7(;+B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV72*([KDXVW 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*([KDXVW(PLVVLRQV7(;+B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*([KDXVW(PLVV LRQV7(;+B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO 3URMHFW7ULSV'XEXTXH$YH 72*(YDSRUDWLYH(PLVVLRQV0RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQJWK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HLJKW P $YHUDJH 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ 7(9$3B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% 7(9$3B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV30(YDSRUDWLYH72* 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK (PLVVLRQVSHU9HKLFOHSHU+RXUJKRXU (PLVVLRQVSHU9HKLFOHSHU0LOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG72*(YDSRUDWLYH(PLVVLRQV7(9$3B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$2II6LWH5HVLGHQWLDO 3URMHFW7ULSV'XEXTXH$YH )XJLWLYH5RDG300RGHOLQJ5RDGZD\/LQNV7UDIILF9ROXPHVDQG)XJLWLYH5RDG30(PLVVLRQV <HDU 5RDG/LQN 'HVFULSWLRQ 'LUHFWLRQ 1R /DQHV /LQN /HQJWK P /LQN /HQ J WK PL /LQN :LGWK P /LQN :LGWK IW 5HOHDVH +HL JKW P $YHUDJ H 6SHHG PSK $YHUDJH 9HKLFOHV SHU'D\ )8*B1%B'8% 'XEXTXH$YHQXH 1RUWKERXQG 1% )8*B6%B'8% 'XEXTXH$YHQXH 6RXWKERXQG 6% 7RWDO (PLVVLRQ)DFWRUV)XJLWLYH30 6SHHG&DWHJRU\ 7UDYHO6SHHGPSK 7LUH:HDU(PLVVLRQVSHU9HKLFOHJ907 %UDNH:HDU(PLVVLRQVSHU9HKLFOHJ907 5RDG'XVW(PLVVLRQVSHU9HKLFOHJ907 RWDO)XJ LWLYH30(PLVVLRQVSHU9HKLFOHJ907 (PLVVRQ)DFWRUVIURP&7(0)$& +RXUO\7UDIILF9ROXPHVDQG)XJLWLYH30(PLVVLRQV)8*B 1%B'8% +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV +RXU 3HU +RXU 93+JV ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO +RXUO\7UDIILF9ROXPHV3HU'LUHFWLRQDQG)XJLWLYH30(PLVVLRQV)8*B6%B'8% +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH +RXU 3HU +RXU 93+JPLOH ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( 7RWDO 'XEXTXH$YH6RXWK6DQ)UDQFLVFR&$'XEXTXH$YHQXH7UDIILF7$&V 303URMHFW7ULSV $(502'5LVN0RGHOLQJ3DUDPHWHUVDQG0D[LPXP&RQFHQWUDWLRQV DW&RQVWUXFWLRQ5HVLGHQWLDO0(,5HFHSWRUV/RFDWLRQPHWHUUHFHSWRUKHLJKW (PLVV LRQ<HDU 5HFHSWRU,QIRUPDWLRQ &RQVWUXFWLRQ6FKRRO0(,UHFHSWRU 1XPEHURI5HFHSWRUV 5HFHSWRU+HLJKW 0HWHUV 5HFHSWRU'LVWDQFHV $W6FKRRO0(,ORFDWLRQ 0HWHRURORJLFDO&RQGLWLRQV %$$40'6DQ)UDQFLVFR,QWHUQDWLRQDO$LUSRUW0 /DQG8VH&ODVVLILFDWLRQ 8UEDQ :LQG6SHHG 9DULDEOH :LQG'LUHFWLRQ 9DULDEOH &RQVWUXFWLRQ6FKRRO0(,&DQFHU5LVN0D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV '30 ([KDXVW72* (YDSRUDWLYH72* &RQVWUXFWLRQ6FKRRO0(,300D[LPXP&RQFHQWUDWLRQV 0HWHRURORJLFDO 'DWD<HDUV 7RWDO30 )XJLWLYH30 9HKLFOH30 &RQFHQWUDWLRQȝJP 30&RQFHQWUDWLRQȝJP 'XEXTXH$YHQXH6RXWK6DQ)UDQFLVFR&$'XEXTXH$YHQXH7UDIILF&DQFHU5LVN3URMHFW7ULSV ,PSDFWVDW&RQVWUXFWLRQ6FKRRO0(,PHWHUUHFHSWRUKHLJKW <HDU5HVLGHQWLDO([SRVXUH &DQFHU5LVN&DOFXODWLRQ0HWKRG &DQFHU5LVNSHUPLOOLRQ &3)[,QKDODWLRQ'RVH[$6)[('$7[)$+[( :KHUH &3) &DQFHUSRWHQF\IDFWRUPJNJGD\ $6) $JHVHQVLWLYLW\IDFWRUIRUVSHFLILHGDJHJURXS (' ([SRVXUHGXUDWLRQ\HDUV $7 $YHUDJLQJWLPHIRUOLIHWLPHFDQFHUULVN\HDUV )$+ )UDFWLRQRIWLPHVSHQWDWKRPHXQLWOHVV ,QKDODWLRQ'RVH &DLU['%5[$[()[ :KHUH &DLU FRQFHQWUDWLRQLQDLUȝJP '%5 GDLO\EUHDWKLQJUDWH/NJERG\ZHLJKWGD\ $ ,QKDODWLRQDEVRUSWLRQIDFWRU () ([SRVXUHIUHTXHQF\GD\V\HDU &RQYHUVLRQIDFWRU &DQFHU3RWHQF\)DFWRUVPJNJGD\ &3) ( 9HKLFOH72*([KDXVW ( 9HKLFOH72*(YDSRUDWLYH ( 9DOXHV ,QIDQW&KLOG $GXOW $JH! UG7ULPHVWHU 3DUDPHWHU $6) '%5 $ () $7 )$+ WKSHUFHQWLOHEUHDWKLQJUDWHVIRULQIDQWVDQGWKSHUFHQWLOHIRUFKLOGUHQDQGDGXOWV &RQVWUXFWLRQ&DQFHU5LVNE\<HDU0D[LPXP,PSDFW5HFHSWRU/RFDWLRQ ([SRVXUH ([SRVXUH 'XUDWLRQ '30 ([KDXVW 72* (YDSRUDWLYH 72* '30 <HDU \HDUV $JH +D]DUG ,QGH[ )XJLWLYH 30 7RWDO 30 7RWDO,QFUHDVHG&DQFHU5LVN 7KLUGWULPHVWHURISUHJQDQF\ 7$& '30 0D[LPXP([SRVXUH,QIRUPDWLRQ 0D[LPXP 727$/ <HDU $JH 6HQVLWLYLW\ )DFWRU ([KDXV W 72* (YDSRUDWLYH 72* &RQFHQWUDWLRQXJP &DQFHU5LVNSHUPLOOLRQ Rail Line Emissions 800 Dubuque Ave - South San Francisco DPM Modeling - Rail Line Information and DPM Emission Rates Caltrain Electrification and Diesel-Powered Freight DPM Emission Rates Year Description Modeled No. Lines Link Width (ft) Link Width (m) Link Length (ft) Link Length (miles) Link Length (m) Release Height (m) No. Trains per Day Train Travel Speed (mph) Average Daily Emission Rate (g/mi/day) Average Daily Emission Rate (g/day) Link Emission Rate (g/s) Link Emission Rate (lb/hr) 2023-2024 Caltrain 1 15 4.6 2,422 0.46 738 5.0 83 40 186.3 85.5 9.89E-04 7.85E-03 Freight Trains 1 15 4.6 2,422 0.46 738 5.0 4 40 16.7 7.7 8.88E-05 7.05E-04 Total - - - 2,935 0.56 894 - 87 - 203.0 93.1 1.08E-03 8.56E-03 2025-2027 Caltrain 1 15 4.6 2,422 0.46 738 5.0 18 40 33.2 15.2 1.76E-04 1.40E-03 Freight Trains 1 15 4.6 2,422 0.46 738 5.0 4 40 13.9 6.4 7.40E-05 5.87E-04 Total - - - 2,935 0.56 894 - 22 - 47.2 21.6 2.50E-04 1.99E-03 Notes:Emission based on Emission Factors for Locomotives, USEPA 2009 (EPA-420-F-09-025) Average emissions calculated for periods 2023-2024 and 2025-2027. Fuel correction factors from Offroad Modeling Change Technical memo, Changes to the Locomotive Inventory, CARB July 2006. PM2.5 calculated as 92% of PM emissions (CARB CEIDERS PM2.5 fractions) Passenger trains assumed to operate for Freight trains assumed to operate for Caltrain Passenger Trains Passenger trains - weekday = Passenger trains - weekend = Passenger trains - Sat only = Total Trains = Annual average daily trains = Locomotive horsepower = Locomotives per train = Engine load = Freight Freight trains per day = 4 7 days/week Locomotive horsepower = 2300 Locomotives per train = 2 Total horsepower = 4600 Locomotive engine load = 0.5 DPM Locomotive Emission Factors (g/hp-hr) Train Type 2023- 2024 2025- 2027 Passenger 0.077 0.059 Freight 0.087 0.072 2025+ emissions are average for 2025-2054. PM2.5 to PM ratio = 1 CARB Fuel Adj Factor 2010 2011+ Passenger 0.717 0.709 Freight 0.851 0.840 Diesel Trains 0.5 24 4 0 28 18 3467 1 0.5 136 83 3285 1 Diesel Trains 104 32 0 24 hours per day 24 hours per day 2023-2024 (Existing) 2025-2027 (with Electrification) Rail Line Impacts at Project Construction MEI 800 Dubuque Ave, South San Francisco, CA - Rail Impacts at Construction MEI Receptor Maximum DPM Cancer Risk and PM2.5 Calculations For Rail Operation at MEI Impacts at Gateway Child Development Center YMCA - 1 meter - Infant Exposure Student Cancer Risk (per million) = CPF x Inhalation Dose x ASF x ED/AT x 1.0E6 Where: CPF = Cancer potency factor (mg/kg-day)-1 ASF = Age sensitivity factor for specified age group ED = Exposure duration (years) AT = Averaging time for lifetime cancer risk (years) Inhalation Dose = Cair x SCAF x 8-Hr BR x A x (EF/365) x 10-6 Where: Cair = concentration in air (ȝg/m3) SCAF = School Child Adjustment Factor (unitless) for source operation and exposures different than 8 hours/day = (24/SHR) x (7days/SDay) x (SCHR/8 hrs) SHR = Hours/day of emission source operation SDay = Number of days per week of source operation SCHR = School operation hours while emission source in operation 8-Hr BR = Eight-hour breathing rate (L/kg body weight-per 8 hrs) A = Inhalation absorption factor EF = Exposure frequency (days/year) 10-6 = Conversion factor Values Infant Child Age --> 0 - <2 2 - <16 Parameter ASF = 10 3 DPM CPF = 1.10E+00 1.10E+00 8-Hr BR* = 1200 520 SCHR = 9 9 SHR = 24 24 SDay = 7 7 A = 1 1 EF = 250 250 AT = 70 70 SCAF = 1.13 1.13 * 95th percentile 8-hr breathing rates for moderate intensity activities Construction Cancer Risk by Year - Maximum Child Development Center Receptor Child - Exposure Information Child Exposure Age* Cancer Maximum Exposure Duration DPM Conc (ug/m3) Sensitivity Risk Hazard Total Year (years) Age Year Annual Factor (per million) Index PM2.5 1 1 0 - 1 2023 0.0148 10 2.15 0.0030 0.015 2 1 1 - 2 2024 0.0148 10 2.15 0.0030 0.015 3 1 2 - 3 2025 0.0034 3 0.06 0.0007 0.003 4 1 3 - 4 2026 0.0034 3 0.06 0.0007 0.003 5 1 4 - 5 2027 0.0034 3 0.06 0.0007 0.003 Total Increased Cancer Risk 4.50 * Children assumed to be 3 months of age with 5 years of exposure to construction emissions ĂƚĞŽĨZĞƋƵĞƐƚ ϲͬϮϴͬϮϬϮϮŽŶƚĂĐƚEĂŵĞĂĐŚĂƌǇWĂůŵĨĨŝůŝĂƚŝŽŶ/ůůŝŶŐǁŽƌƚŚΘZŽĚŬŝŶ͕/ŶĐ͘WŚŽŶĞϳϬϳͲϳϵϰͲϬϰϬϬǆϭϭϳŵĂŝůǌƉĂůŵΛŝůůŝŶŐǁŽƌƚŚƌŽĚŬŝŶ͘ĐŽŵWƌŽũĞĐƚEĂŵĞϴϬϬƵďƵƋƵĞĚĚƌĞƐƐϴϬϬƵďƵƋƵĞǀĞŝƚǇ^ŽƵƚŚ^ĂŶ&ƌĂŶĐŝƐĐŽŽƵŶƚǇ^ĂŶDĂƚĞŽdǇƉĞ;ƌĞƐŝĚĞŶƚŝĂů͕ĐŽŵŵĞƌĐŝĂů͕ŵŝǆĞĚƵƐĞ͕ŝŶĚƵƐƚƌŝĂů͕ĞƚĐ͘ͿKĨĨŝĐĞͬZΘWƌŽũĞĐƚ^ŝǌĞ;ηŽĨƵŶŝƚƐŽƌďƵŝůĚŝŶŐƐƋƵĂƌĞĨĞĞƚͿϵϬϬŬƐƋĨƚdĂďůĞ͗ZĞƋƵĞƐƚĞƌŽŶƚĂĐƚ/ŶĨŽƌŵĂƚŝŽŶŽŵŵĞŶƚƐ͗ZŝƐŬΘ,ĂǌĂƌĚ^ƚĂƚŝŽŶĂƌǇ^ŽƵƌĐĞ/ŶƋƵŝƌǇ&ŽƌŵdŚŝƐĨŽƌŵŝƐƌĞƋƵŝƌĞĚǁŚĞŶƵƐĞƌƐƌĞƋƵĞƐƚƐƚĂƚŝŽŶĂƌǇ ƐŽƵƌĐĞĚĂƚĂĨƌŽŵYDdŚŝƐĨŽƌŵŝƐƚŽďĞƵƐĞĚǁŝƚŚƚŚĞYDΖƐ'ŽŽŐůĞĂƌƚŚƐƚĂƚŝŽŶĂƌǇƐŽƵƌĐĞƐĐƌĞĞŶŝŶŐƚĂďůĞƐ. ůŝĐŬŚĞƌĞĨŽƌŐƵŝĚĂŶĐĞŽŶĐŽĚƵĐƚŝŶŐƌŝƐŬΘŚĂǌĂƌĚƐĐƌĞĞŶŝŶŐ͕ŝŶĐůƵĚŝŶŐƌŽĂĚǁĂǇƐΘĨƌĞĞǁĂǇƐ͕ƌĞĨĞƌƚŽƚŚĞŝƐƚƌŝĐƚΖƐZŝƐŬΘ,ĂǌĂƌĚŶĂůǇƐŝƐĨůŽǁĐŚĂƌƚ͘ůŝĐŬŚĞƌĞĨŽƌŝƐƚƌŝĐƚΖƐZĞĐŽŵŵĞŶĚĞĚDĞƚŚŽĚƐĨŽƌ^ĐƌĞĞŶŝŶŐĂŶĚDŽĚĞůŝŶŐ>ŽĐĂůZŝƐŬƐĂŶĚ,ĂǌĂƌĚƐĚŽĐƵŵĞŶƚ͘&ŽƌŝƌŝƐƚƌŝĐƚĂƐƐŝƐƚĂŶĐĞ͕ ƚŚĞĨŽůůŽǁŝŶŐƐƚĞƉƐŵƵƐƚďĞĐŽŵƉůĞƚĞĚ͗ϭ͘ŽŵƉůĞƚĞĂůůƚŚĞĐŽŶƚĂĐƚĂŶĚƉƌŽũĞĐƚŝŶĨŽƌŵĂƚŝŽŶƌĞƋƵĞƐƚĞĚŝŶ ͘/ŶĐŽŵƉůĞƚĞĨŽƌŵƐǁŝůůŶŽƚďĞƉƌŽĐĞƐƐĞĚ͘WůĞĂƐĞŝŶĐůƵĚĞĂƉƌŽũĞĐƚƐŝƚĞŵĂƉ͘Ϯ͘ŽǁŶůŽĂĚĂŶĚŝŶƐƚĂůůƚŚĞĨƌĞĞƉƌŽŐƌĂŵ'ŽŽŐůĞĂƌƚŚ͕ŚƚƚƉ͗ͬͬǁǁǁ͘ŐŽŽŐůĞ͘ĐŽŵͬĞĂƌƚŚͬĚŽǁŶůŽĂĚͬŐĞ͕ͬĂŶĚƚŚĞŶĚŽǁŶůŽĂĚƚŚĞĐŽƵŶƚǇƐƉĞĐŝĨŝĐ'ŽŽŐůĞĂƌƚŚƐƚĂƚŝŽŶĂƌǇƐŽƵƌĐĞĂƉƉůŝĐĂƚŝŽŶĨŝůĞƐĨƌŽŵƚŚĞŝƐƚƌŝĐƚΖƐǁĞďƐŝƚĞ͕ŚƚƚƉ͗ͬͬǁǁǁ͘ďĂĂƋŵĚ͘ŐŽǀͬŝǀŝƐŝŽŶƐͬWůĂŶŶŝŶŐͲĂŶĚͲZĞƐĞĂƌĐŚͬYͲ'h/>/E^ͬdŽŽůƐͲĂŶĚͲDĞƚŚŽĚŽůŽŐǇ͘ĂƐƉǆ͘dŚĞƐŵĂůůƉŽŝŶƚƐŽŶƚŚĞŵĂƉƌĞƉƌĞƐĞŶƚƐƚĂƚŝŽŶĂƌǇƐŽƵƌĐĞƐƉĞƌŵŝƚƚĞĚďǇƚŚĞŝƐƚƌŝĐƚ;DĂƉŽŶƌŝŐŚƚͿ͘dŚĞƐĞƉĞƌŵŝƚƚĞĚƐŽƵƌĐĞƐŝŶĐůƵĚĞĚŝĞƐĞůďĂĐŬͲƵƉŐĞŶĞƌĂƚŽƌƐ͕ŐĂƐƐƚĂƚŝŽŶƐ͕ĚƌǇĐůĞĂŶĞƌƐ͕ďŽŝůĞƌƐ͕ƉƌŝŶƚĞƌƐ͕ĂƵƚŽƐƉƌĂǇďŽŽƚŚƐ͕ĞƚĐ͘ůŝĐŬŽŶĂƉŽŝŶƚƚŽǀŝĞǁƚŚĞƐŽƵƌĐĞΖƐ/ŶĨŽƌŵĂƚŝŽŶdĂďůĞ͕ŝŶĐůƵĚŝŶŐƚŚĞŶĂŵĞ͕ůŽĐĂƚŝŽŶ͕ĂŶĚƉƌĞůŝŵŝŶĂƌǇĞƐƚŝŵĂƚĞĚĐĂŶĐĞƌƌŝƐŬ͕ŚĂǌĂƌĚŝŶĚĞǆ͕ĂŶĚWDϮ͘ϱĐŽŶĐĞŶƚƌĂƚŝŽŶ͘ϯ͘&ŝŶĚƚŚĞƉƌŽũĞĐƚƐŝƚĞŝŶ'ŽŽŐůĞĂƌƚŚďǇŝŶƉƵƚƚŝŶŐƚŚĞƐŝƚĞΖƐĂĚĚƌĞƐƐŝŶƚŚĞ'ŽŽŐůĞĂƌƚŚƐĞĂƌĐŚďŽǆ͘ϰ͘/ĚĞŶƚŝĨǇƐƚĂƚŝŽŶĂƌǇƐŽƵƌĐĞƐǁŝƚŚŝŶĂƚůĞĂƐƚĂϭϬϬϬĨƚƌĂĚŝƵƐŽĨƉƌŽũĞĐƚƐŝƚĞ͘sĞƌŝĨǇƚŚĂƚƚŚĞůŽĐĂƚŝŽŶŽĨƚŚĞƐŽƵƌĐĞŽŶƚŚĞŵĂƉŵĂƚĐŚĞƐǁŝƚŚƚŚĞƐŽƵƌĐĞΖƐĂĚĚƌĞƐƐŝŶƚŚĞ/ŶĨŽƌŵĂƚŝŽŶdĂďůĞ͕ďǇƵƐŝŶŐƚŚĞ'ŽŽŐůĞĂƌƚŚĂĚĚƌĞƐƐƐĞĂƌĐŚďŽǆƚŽĐŽŶĨŝƌŵƚŚĞƐŽƵƌĐĞΖƐĂĚĚƌĞƐƐůŽĐĂƚŝŽŶ͘WůĞĂƐĞƌĞƉŽƌƚĂŶǇŵĂƉƉŝŶŐĞƌƌŽƌƐƚŽƚŚĞŝƐƚƌŝĐƚ͘ϱ͘>ŝƐƚƚŚĞƐƚĂƚŝŽŶĂƌǇƐŽƵƌĐĞŝŶĨŽƌŵĂƚŝŽŶŝŶ ďůƵĞƐĞĐƚŝŽŶŽŶůǇ͘ϲ͘EŽƚĞƚŚĂƚĂƐŵĂůůƉĞƌĐĞŶƚĂŐĞŽĨƚŚĞƐƚĂƚŝŽŶĂƌǇƐŽƵƌĐĞƐŚĂǀĞ,ĞĂůƚŚZŝƐŬ^ĐƌĞĞŶŝŶŐƐƐĞƐƐŵĞŶƚ;,Z^ͿĚĂƚĂ/E^dŽĨƐĐƌĞĞŶŝŶŐ ůĞǀĞůĚĂƚĂ͘dŚĞƐĞƐŽƵƌĐĞƐǁŝůůďĞŶŽƚĞĚďǇĂŶĂƐƚĞƌŝƐŬŶĞǆƚƚŽƚŚĞWůĂŶƚEĂŵĞ;DĂƉŽŶƌŝŐŚƚͿ͘/Ĩ,Z^ǀĂůƵĞƐĂƌĞƉƌĞƐĞŶƚĞĚ͕ƚŚĞƐĞǀĂůƵĞƐŚĂǀĞĂůƌĞĂĚǇ ďĞĞŶŵŽĚĞůĞĚĂŶĚĐĂŶŶŽƚďĞĂĚũƵƐƚĞĚĨƵƌƚŚĞƌ͘ϳ͘ŵĂŝůƚŚŝƐĐŽŵƉůĞƚĞĚĨŽƌŵƚŽŝƐƚƌŝĐƚƐƚĂĨĨ͘ŝƐƚƌŝĐƚƐƚĂĨĨǁŝůůƉƌŽǀŝĚĞƚŚĞŵŽƐƚƌĞĐĞŶƚƌŝƐŬ͕ŚĂǌĂƌĚ͕ĂŶĚWDϮ͘ϱĚĂƚĂƚŚĂƚĂƌĞĂǀĂŝůĂďůĞĨŽƌƚŚĞƐŽƵƌĐĞ;ƐͿ͘/ĨƚŚŝƐŝŶĨŽƌŵĂƚŝŽŶŽƌĚĂƚĂĂƌĞŶŽƚĂǀĂŝůĂďůĞ͕ƐŽƵƌĐĞĞŵŝƐƐŝŽŶƐĚĂƚĂǁŝůůďĞƉƌŽǀŝĚĞĚ͘^ƚĂĨĨǁŝůůƌĞƐƉŽŶĚƚŽŝŶƋƵŝƌŝĞƐǁŝƚŚŝŶƚŚƌĞĞǁĞĞŬƐ͘EŽƚĞƚŚĂƚĂƉƵďůŝĐƌĞĐŽƌĚƐƌĞƋƵĞƐƚƌĞĐĞŝǀĞĚĨŽƌƚŚĞƐĂŵĞƐƚĂƚŝŽŶĂƌǇƐŽƵƌĐĞŝŶĨŽƌŵĂƚŝŽŶǁŝůůĐĂŶĐĞůƚŚĞƉƌŽĐĞƐƐŝŶŐŽĨǇŽƵƌ^^/&ƌĞƋƵĞƐƚ͘^ƵďŵŝƚĨŽƌŵƐ͕ŵĂƉƐ͕ĂŶĚƋƵĞƐƚŝŽŶƐƚŽƌĞĂŶĂ&ůŽƌĞƐĂƚϰϭϱͲϳϰϵͲϰϲϭϲ͕ŽƌĂĨůŽƌĞƐΛďĂĂƋŵĚ͘ŐŽǀdĂďůĞ͗ZĞƋƵĞƐƚĞƌŽŶƚĂĐƚ/ŶĨŽƌŵĂƚŝŽŶdĂďůĞdĂďůĞ ŽŶƐƚƌƵĐƚŝŽŶD/ƐŝƐƚĂŶĐĞĨƌŽŵZĞĐĞƉƚŽƌ;ĨĞĞƚͿŽƌD/ϭWůĂŶƚEŽ͘ &ĂĐŝůŝƚǇEĂŵĞ ĚĚƌĞƐƐ ĂŶĐĞƌZŝƐŬϮ,ĂǌĂƌĚZŝƐŬϮWDϮ͘ϱϮ^ŽƵƌĐĞEŽ͘ϯdǇƉĞŽĨ^ŽƵƌĐĞϰ&ƵĞůŽĚĞϱ^ƚĂƚƵƐͬŽŵŵĞŶƚƐŝƐƚĂŶĐĞĚũƵƐƚŵĞŶƚDƵůƚŝƉůŝĞƌĚũƵƐƚĞĚĂŶĐĞƌZŝƐŬƐƚŝŵĂƚĞĚũƵƐƚĞĚ,ĂǌĂƌĚZŝƐŬĚũƵƐƚĞĚWDϮ͘ϱϮϬϬ ϭϲϬϮϰ 'ĞŶĞŶƚĞĐŚ͕/ŶĐ ϲϭϭ'ĂƚĞǁĂǇŽƵůĞǀĂƌĚ ϭ͘ϵϱ Ϭ͘ϬϬ Ϭ͘ϬϬ 'ĞŶĞƌĂƚŽƌ ϮϬϮϬĂƚĂƐĞƚϬ͘ϰϭ Ϭ͘ϴϬ Ϭ͘ϬϬϮ Ϭ͘ϬϬϭϱϬ ϭϰϬϭϬ ŽƐƚŽŶWƌŽƉĞƌƚŝĞƐ ϲϬϭ'ĂƚĞǁĂǇŽƵůĞǀĂƌĚ ϲ͘Ϭϳ Ϭ͘ϬϬ Ϭ͘Ϭϭ 'ĞŶĞƌĂƚŽƌ ϮϬϮϬĂƚĂƐĞƚϬ͘ϱϴ ϯ͘ϱϮ Ϭ͘ϬϬϭ Ϭ͘ϬϬϵϱϬ ϮϬϮϯϲŝŽƚĞĐŚ'ĂƚĞǁĂǇͲ,WĐͬŽZ ϮŽƌƉŽƌĂƚĞƌŝǀĞ ϭ͘ϲϲ Ϭ͘ϬϬ Ϭ͘ϬϬ 'ĞŶĞƌĂƚŽƌ ϮϬϮϬĂƚĂƐĞƚϬ͘Ϭϰ Ϭ͘Ϭϳ Ϭ͘ϬϬϬ Ϭ͘ϬϬϴϱϬ ϭϵϭϳϵ DĂĐƌŽ'ĞŶŝĐƐtĞƐƚ͕/ŶĐ KŶĞŽƌƉŽƌĂƚĞƌŝǀĞ ϯϵ͘ϲϭ Ϭ͘ϬϮ Ϭ͘Ϭϱ 'ĞŶĞƌĂƚŽƌ ϮϬϮϬĂƚĂƐĞƚ Ϭ͘Ϭϲ Ϯ͘ϯϴ Ϭ͘ϬϬϭ Ϭ͘ϬϬϱϯϬ ϭϳϱϴϰůĞǆĂŶĚƌŝĂZĞĂůƐƚĂƚĞƋƵŝƚŝĞƐ/ŶĐ ϲϴϭ'dtz>s ϭϳ͘ϰϵ Ϭ͘Ϭϭ Ϭ͘ϬϮ 'ĞŶĞƌĂƚŽƌ ϮϬϮϬĂƚĂƐĞƚϬ͘ϭϬ ϭ͘ϳϱ Ϭ͘ϬϬϭ Ϭ͘ϬϬϭϬϬϬн ϭϴϰϬϭ >ŽǁĞΖƐ,/t/ŶĐ ϳϮϬƵďƵƋƵĞǀĞŶƵĞ ϵ͘ϰϳ Ϭ͘ϬϬ Ϭ͘Ϭϭ 'ĞŶĞƌĂƚŽƌϮϬϮϬĂƚĂƐĞƚ Ϭ͘Ϭϰ Ϭ͘ϯϴ Ϭ͘ϬϬϬ Ϭ͘ϬϬϭϬϬϬн Ϯϯϯϭϭ ,ĞĂůƚŚWůĂŶŽĨ^ĂŶDĂƚĞŽ ϴϬϭ'ĂƚĞǁĂǇŽƵůĞǀĂƌĚ ϭ͘ϰϵ Ϭ͘ϬϬϬ͘ϬϬ 'ĞŶĞƌĂƚŽƌ ϮϬϮϬĂƚĂƐĞƚϬ͘Ϭϰ Ϭ͘Ϭϲ Ϭ͘ϬϬϬ Ϭ͘ϬϬϯϮϬ Ϯϰϳϵϰ ϲϭϭ'ĂƚĞǁĂǇĞŶƚĞƌ>W ϲϭϭ'ĂƚĞǁĂǇŽƵůĞǀĂƌĚ Ϯ͘ϰϰ Ϭ͘Ϭϭ Ϭ͘ϰϯ EŽĂƚĂ ϮϬϮϬĂƚĂƐĞƚϬ͘ϱϭ ϭ͘Ϯϯ Ϭ͘ϬϬϯ Ϭ͘ϮϮϲϯϬ Ϯϰϳϵϱ ϲϬϭΘϲϱϭ'ĂƚĞǁĂǇĞŶƚĞƌ>W ϲϱϭ'ĂƚĞǁĂǇŽƵůĞǀĂƌĚ ϮϬ͘Ϯϱ Ϭ͘Ϭϯ Ϭ͘ϯϯ EŽĂƚĂ ϮϬϮϬĂƚĂƐĞƚϬ͘Ϯϳ ϱ͘ϰϵ Ϭ͘ϬϬϵ Ϭ͘ϬϵϭϬϬϬн ϭϭϭϭϳϬͺϭ ŝƌƉŽƌƚŽƵůĞǀĂƌĚ^ŚĞůů ϴϵϵŝƌƉŽƌƚůǀĚ ϭϵ͘ϯϲ Ϭ͘Ϭϵ Ϭ͘ϬϬ'ĂƐŝƐƉĞŶƐŝŶŐ&ĂĐŝůŝƚǇ ϮϬϮϬĂƚĂƐĞƚϬ͘ϬϮ Ϭ͘Ϯϵ Ϭ͘ϬϬϭ Ϭ͘ϬϬ&ŽŽƚŶŽƚĞƐ͗ϭ͘DĂǆŝŵĂůůǇĞǆƉŽƐĞĚŝŶĚŝǀŝĚƵĂůĐ͘YDZĞŐϭϭZƵůĞϭϲƌĞƋƵŝƌĞĚƚŚĂƚĂůůĐŽͲƌĞƐŝĚĞŶƚŝĂů;ƐŚĂƌŝŶŐĂǁĂůů͕ĨůŽŽƌ͕ĐĞŝůŝŶŐŽƌŝƐŝŶƚŚĞƐĂŵĞďƵŝůĚŝŶŐĂƐĂƌĞƐŝĚĞŶƚŝĂůƵŶŝƚͿĚƌǇĐůĞĂŶĞƌƐĐĞĂƐĞƵƐĞŽĨƉĞƌĐŽŶ:ƵůǇϭ͕ϮϬϭϬ͘ĂƚĞůĂƐƚƵƉĚĂƚĞĚ͗ϬϯͬϭϯͬϮϬϭϴŐ͘dŚŝƐƐƉƌĂǇďŽŽƚŚŝƐĐŽŶƐŝĚĞƌĞĚƚŽďĞŝŶƐŝŐŶŝĨŝĐĂŶƚ͘ϰ͘WĞƌŵŝƚƚĞĚƐŽƵƌĐĞƐŝŶĐůƵĚĞĚŝĞƐĞůďĂĐŬͲƵƉŐĞŶĞƌĂƚŽƌƐ͕ŐĂƐƐƚĂƚŝŽŶƐ͕ĚƌǇĐůĞĂŶĞƌƐ͕ďŽŝůĞƌƐ͕ƉƌŝŶƚĞƌƐ͕ĂƵƚŽƐƉƌĂǇďŽŽƚŚƐ͕ĞƚĐ͘ϭϭ͘&ƵƌƚŚĞƌŝŶĨŽƌŵĂƚŝŽŶĂďŽƵƚĐŽŵŵŽŶƐŽƵƌĐĞƐ͗Ă͘^ŽƵƌĐĞƐƚŚĂƚŽŶůǇŝŶĐůƵĚĞĚŝĞƐĞůŝŶƚĞƌŶĂůĐŽŵďƵƐƚŝŽŶĞŶŐŝŶĞƐĐĂŶďĞĂĚũƵƐƚĞĚƵƐŝŶŐƚŚĞYDΖƐŝĞƐĞůDƵůƚŝƉůŝĞƌǁŽƌŬƐŚĞĞƚ͘ď͘dŚĞƌŝƐŬĨƌŽŵŶĂƚƵƌĂůŐĂƐďŽŝůĞƌƐƵƐĞĚĨŽƌƐƉĂĐĞŚĞĂƚŝŶŐǁŚĞŶфϮϱDDdhͬŚƌǁŽƵůĚŚĂǀĞĂŶĞƐƚŝŵĂƚĞĚĐĂŶĐĞƌƌŝƐŬŽĨŽŶĞŝŶĂŵŝůůŝŽŶŽƌůĞƐƐ͕ĂŶĚĂĐŚƌŽŶŝĐŚĂǌĂƌĚŝŶĚĞǆŽĨdŚĞƌĞĨŽƌĞ͕ƚŚĞƌĞŝƐŶŽĐĂŶĐĞƌƌŝƐŬ͕ŚĂǌĂƌĚŽƌWDϮ͘ϱĐŽŶĐĞŶƚƌĂƚŝŽŶƐĨƌŽŵĐŽͲƌĞƐŝĚĞŶƚŝĂůĚƌǇĐůĞĂŶŝŶŐďƵƐŝŶĞƐƐĞƐŝŶƚŚĞYD͘Ě͘EŽŶĐŽͲƌĞƐŝĚĞŶƚŝĂůĚƌǇĐůĞĂŶĞƌƐŵƵƐƚƉŚĂƐĞŽƵƚƵƐĞŽĨƉĞƌĐďǇ:ĂŶ͘ϭ͕ϮϬϮϯ͘dŚĞƌĞĨŽƌĞ͕ƚŚĞƌŝƐŬĨƌŽŵƚŚĞƐĞĚƌǇĐůĞĂŶĞƌƐĚŽĞƐŶŽƚŶĞĞĚƚŽďĞĨĂĐƚŽƌĞĚŝŶŽǀĞƌĂϳϬͲǇĞĂƌƉĞƌŝŽĚ͕ďƵƚŝŶƐƚĞĂĚƐŚŽƵůĚƌĞĨůĞĐƚƚŚĞŶƵŵďĞƌŽĨǇĞĂƌƐƉĞƌĐƵƐĞǁŝůůĐŽŶƚŝŶƵĞĂĨƚĞƌƚŚĞƉƌŽũĞĐƚΖƐƌĞƐŝĚĞŶƚƐŽƌŽƚŚĞƌƐĞŶƐŝƚŝǀĞƌĞĐĞƉƚŽƌƐ;ƐƵĐŚĂƐƐƚƵĚĞŶƚƐ͕ƉĂƚŝĞŶƚƐ͕ĞƚĐͿƚĂŬĞŽĐĐƵƉĂŶĐǇ͘Ğ͘'ĂƐƐƚĂƚŝŽŶƐĐĂŶďĞĂĚũƵƐƚĞĚƵƐŝŶŐYDΖƐ'ĂƐ^ƚĂƚŝŽŶŝƐƚĂŶĐĞDƵůŝƚƉůŝĞƌǁŽƌŬƐŚĞĞƚ͘ϲ͘/ĨĂ,ĞĂůƚŚZŝƐŬ^ĐƌĞĞŶŝŶŐƐƐĞƐƐŵĞŶƚ;,Z^ͿǁĂƐĐŽŵƉůĞƚĞĚĨŽƌƚŚĞƐŽƵƌĐĞ͕ƚŚĞĂƉƉůŝĐĂƚŝŽŶŶƵŵďĞƌǁŝůůďĞůŝƐƚĞĚŚĞƌĞ͘ϳ͘dŚĞĚĂƚĞƚŚĂƚƚŚĞ,Z^ǁĂƐĐŽŵƉůĞƚĞĚ͘ϴ͘ŶŐŝŶĞĞƌǁŚŽĐŽŵƉůĞƚĞĚƚŚĞ,Z^͘&ŽƌŝƐƚƌŝĐƚƉƵƌƉŽƐĞƐŽŶůǇ͘ϵ͘ůů,Z^ĐŽŵƉůĞƚĞĚďĞĨŽƌĞϭͬϱͬϮϬϭϬŶĞĞĚƚŽďĞŵƵůƚŝƉůŝĞĚďǇĂŶĂŐĞƐĞŶƐŝƚŝǀŝƚǇĨĂĐƚŽƌŽĨϭ͘ϳ͘ϭϬ͘dŚĞ,Z^ΗŚƌŽŶŝĐ,ĞĂůƚŚΗŶƵŵďĞƌƌĞƉƌĞƐĞŶƚƐƚŚĞ,ĂǌĂƌĚ/ŶĚĞǆ͘ϱ͘&ƵĞůĐŽĚĞƐ͗ϵϴсĚŝĞƐĞů͕ϭϴϵсEĂƚƵƌĂů'ĂƐ͘Ϯ͘dŚĞƐĞĂŶĐĞƌZŝƐŬ͕,ĂǌĂƌĚ/ŶĚĞǆ͕ĂŶĚWDϮ͘ϱĐŽůƵŵŶƐƌĞƉƌĞƐĞŶƚƚŚĞǀĂůƵĞƐŝŶƚŚĞ'ŽŽŐůĞĂƌƚŚWůĂŶƚ/ŶĨŽƌŵĂƚŝŽŶdĂďůĞ͘ϯ͘ĂĐŚƉůĂŶƚŵĂǇŚĂǀĞŵƵůƚŝƉůĞƉĞƌŵŝƚƐĂŶĚƐŽƵƌĐĞƐ͘Ĩ͘hŶůĞƐƐŽƚŚĞƌǁŝƐĞŶŽƚĞĚ͕ĞǆĞŵƉƚƐŽƵƌĐĞƐĂƌĞĐŽŶƐŝĚĞƌĞĚŝŶƐŝŐŶŝĨŝĐĂŶƚ͘^ĞĞYDZĞŐϮZƵůĞϭĨŽƌĂůŝƐƚŽĨĞǆĞŵƉƚƐŽƵƌĐĞƐ͘dĂďůĞ͗'ŽŽŐůĞĂƌƚŚĚĂƚĂ &8/785$/5(&25'66($5&+1$7,9($0(5,&$1+(5,7$*( &200,66,215(63216( #66#%*/'06$ WRWKH 'XEXTXH$YHQXH3URMHFW,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ -XO\1:,&)LOH1R -HQQD6XQGHUOLQ /DPSKLHU*UHJRU\,QF 5HGZRRG5RDG67($ 2DNODQG&$ 5H5HFRUGVHDUFKUHVXOWVIRUWKHSURSRVHG'XEXTXH$YHQXH3URMHFWLQWKH&LW\RI6RXWK 6DQ)UDQFLVFR 'HDU-HQQD6XQGHUOLQ 3HU\RXUUHTXHVWUHFHLYHGE\RXURIILFHRQWKHWKRI-XO\DUDSLGUHVSRQVHUHFRUGV VHDUFKZDVFRQGXFWHGIRUWKHDERYHUHIHUHQFHGSURMHFWE\UHYLHZLQJSHUWLQHQW1RUWKZHVW ,QIRUPDWLRQ&HQWHU1:,&EDVHPDSVWKDWUHIHUHQFHFXOWXUDOUHVRXUFHVUHFRUGVDQGUHSRUWV KLVWRULFSHULRGPDSVDQGOLWHUDWXUHIRU$ODPHGD&RXQW\3OHDVHQRWHWKDWXVHRIWKHWHUP FXOWXUDOUHVRXUFHVLQFOXGHVERWKDUFKDHRORJLFDOUHVRXUFHVDQGKLVWRULFDOEXLOGLQJVDQGRU VWUXFWXUHV 7KHSURMHFWSURSRVHVWRGHPROLVKDOOH[LVWLQJLPSURYHPHQWVDQGFRQVWUXFWDSSUR[LPDWHO\ VTXDUHIHHWRIRIILFH5 'VSDFHLQQHZEXLOGLQJVLQFOXGLQJDFFHVVRU\HYHQWFHQWHU IRRGEHYHUDJHDQGILWQHVVFHQWHUXVHV7KHSURMHFWZLOOLQYROYHH[FDYDWLRQIRUVXEVXUIDFH SDUNLQJDFURVVWKHPDMRULW\RIWKHVLWHH[WHQGLQJWRGHSWKVRIDSSUR[LPDWHO\IHHWEHORZ JURXQGVXUIDFH 5HYLHZRIWKHLQIRUPDWLRQDWRXURIILFHLQGLFDWHVWKDWWKHUHKDVEHHQILYHFXOWXUDOUHVRXUFH VWXGLHVWKDWFRYHUXSWRDSSUR[LPDWHO\RIWKH'XEXTXH$YHQXHSURMHFWDUHD2QH VWXG\E\&DUWLHU6FRYHUHGXSWRRIWKHSURMHFWDUHDZLWKILHOGVXUYH\DQG WHVWLQJ-XULFKHWDO6LQFOXGHGRIWKHSURMHFWDUHDZLWKLQLWV5HVHDUFK$UHD RQO\DQGWKHRWKHUWKUHHVWXGLHVZHUHODUJHUDGMDFHQWVWXGLHVWKDWLQFOXGHGXSWRRIWKH FXUUHQWSURMHFWDUHD+DWRIIHWDO6&DUULFRHWDO6DQG1HOVRQHWDO 66HHHQFORVHG5HSRUW/LVW 7KLV'XEXTXH$YHQXHSURMHFWDUHDFRQWDLQVQRUHFRUGHGDUFKDHRORJLFDOUHVRXUFHV7KH 6WDWH2IILFHRI+LVWRULF3UHVHUYDWLRQ%XLOW(QYLURQPHQW5HVRXUFHV'LUHFWRU\2+3%(5' ZKLFKLQFOXGHVOLVWLQJVRIWKH&DOLIRUQLD5HJLVWHURI+LVWRULFDO5HVRXUFHV&DOLIRUQLD6WDWH +LVWRULFDO/DQGPDUNV&DOLIRUQLD6WDWH3RLQWVRI+LVWRULFDO,QWHUHVWDQGWKH1DWLRQDO5HJLVWHURI +LVWRULF3ODFHVOLVWVQRUHFRUGHGEXLOGLQJVRUVWUXFWXUHVZLWKLQRUDGMDFHQWWRWKHSURSRVHG Ϯ ϮϮͲϬϬϵϰ 'XEXTXH$YHQXHSURMHFWDUHD,QDGGLWLRQWRWKHVHLQYHQWRULHVWKH1:,&EDVHPDSVVKRZQR UHFRUGHGEXLOGLQJVRUVWUXFWXUHVZLWKLQWKHSURSRVHG'XEXTXH$YHQXHSURMHFWDUHD $WWKHWLPHRI(XURDPHULFDQFRQWDFWWKH1DWLYH$PHULFDQVWKDWOLYHGLQWKHDUHDZHUHVSHDNHUV RIWKH5DPD\WXVKODQJXDJHZKLFKLVSDUWRIWKH&RVWDQRDQ2KORQHODQJXDJHIDPLO\/HY\ 7KHUHLVRQH1DWLYH$PHULFDQUHVRXUFHZLWKLQRUDGMDFHQWWRWKHSURSRVHG 'XEXTXH$YHQXHSURMHFWDUHDWKDWDUHUHIHUHQFHGLQWKHHWKQRJUDSKLFOLWHUDWXUH>YLOODJHRI Sipliskin/HY\0LOOLNHQ1HOVRQ@ %DVHGRQDQHYDOXDWLRQRIWKHHQYLURQPHQWDOVHWWLQJDQGIHDWXUHVDVVRFLDWHGZLWKNQRZQVLWHV 1DWLYH$PHULFDQUHVRXUFHVLQWKLVSDUWRI6DQ0DWHR&RXQW\KDYHEHHQIRXQGLQDUHDVPDUJLQDO WR6DQ)UDQFLVFR%D\DQGLQODQGRQULGJHVPLGVORSHEHQFKHVLQYDOOH\VQHDULQWHUPLWWHQWDQG SHUHQQLDOZDWHUFRXUVHVDQGQHDUDUHDVSRSXODWHGE\RDNEXFNH\HPDQ]DQLWDDQGSLQHDV ZHOODVQHDUDYDULHW\RISODQWDQGDQLPDOUHVRXUFHV7KH'XEXTXH$YHQXHSURMHFWDUHDLV ORFDWHGDWWKHZHVWHUQHQGRI3RLQW6DQ%UXQRDWDORZSRLQWEHWZHHQ6DQ%UXQR0RXQWDLQDQG WKHZHVWHUQPRVWKLOORI3RLQW6DQ%UXQR7KHSURMHFWDUHDLVORFDWHGDSSUR[LPDWHO\PHWHUV IURPWKHKLVWRULF6DQ)UDQFLVFRED\VKRUHPDUJLQVDQGDVVRFLDWHGPDUVKODQGVDQGDGMDFHQWWR DIRUPHUFUHHN$HULDOPDSVLQGLFDWHDIXOO\SDYHGRYHUSDUFHOZLWKEXLOGLQJV*LYHQWKHVLPLODULW\ RIWKHVHHQYLURQPHQWDOIDFWRUVDQGWKHDUFKDHRORJLFDODQGHWKQRJUDSKLFVHQVLWLYLW\RIWKHDUHD WKHUHLVDPRGHUDWHO\KLJKSRWHQWLDOIRUXQUHFRUGHG1DWLYH$PHULFDQUHVRXUFHVWREHZLWKLQWKH SURSRVHG'XEXTXH$YHQXHSURMHFWDUHD 5HYLHZRIKLVWRULFDOOLWHUDWXUHDQGPDSVLQGLFDWHGKLVWRULFSHULRGDFWLYLW\ZLWKLQWKH'XEXTXH $YHQXHSURMHFWDUHD(DUO\6DQ0DWHR&RXQW\PDSVLQGLFDWHGWKHSURMHFWDUHDZDVORFDWHG ZLWKLQWKHODQGKROGLQJVRIWKH6RXWK6DQ)UDQFLVFR/DQG ,PSURYHPHQW&RDQGDGMDFHQWWRD SRUWLRQRIWKH6RXWKHUQ3DFLILF5DLOURDG$VWKHUHDUHQREXLOGLQJVLQGLFDWHGRQWKHPDSVDWWKDW WLPHLWLVXQFOHDULIWKHDUHDZDVGHYHORSHGDWWKDWWLPH:LWKWKLVLQIRUPDWLRQLQPLQGWKHUHLVD PRGHUDWHSRWHQWLDOIRUXQUHFRUGHGKLVWRULFSHULRGDUFKDHRORJLFDOUHVRXUFHVWREHZLWKLQWKH SURSRVHG'XEXTXH$YHQXHSURMHFWDUHD 7KH6DQ)UDQFLVFR6RXWK86*6PLQXWHWRSRJUDSKLFTXDGUDQJOHGHSLFWVRQHEXLOGLQJ DQGDUDLOURDGVSXUZLWKLQWKH'XEXTXH$YHQXHSURMHFWDUHD,ISUHVHQWWKHVHXQUHFRUGHG EXLOGLQJDQGVWUXFWXUHPHHWWKH2IILFHRI+LVWRULF3UHVHUYDWLRQ¶VPLQLPXPDJHVWDQGDUGWKDW EXLOGLQJVVWUXFWXUHVDQGREMHFWV\HDUVRUROGHUPD\EHRIKLVWRULFDOYDOXH 5(&200(1'$7,216 7KHUHLVDPRGHUDWHO\KLJKSRWHQWLDOIRU1DWLYH$PHULFDQDUFKDHRORJLFDOUHVRXUFHV DQGDPRGHUDWHSRWHQWLDOIRUKLVWRULFSHULRGDUFKDHRORJLFDOUHVRXUFHVWREHZLWKLQWKHSURMHFW DUHD'XHWRWKHSDVVDJHRIWLPHVLQFHWKHSUHYLRXVVWXG\WKDWLQFOXGHGDSSUR[LPDWHO\RI WKHSURMHFWDUHD&DUWLHUDQGWKHFKDQJHVLQDUFKDHRORJLFDOWKHRU\DQGPHWKRGVLQFHWKDW WLPHZHUHFRPPHQGDTXDOLILHGDUFKDHRORJLVWFRQGXFWIXUWKHUDUFKLYDODQGILHOGVWXG\IRUWKH HQWLUHSURMHFWDUHDWRLGHQWLI\DUFKDHRORJLFDOUHVRXUFHV 2XUXVXDOUHFRPPHQGDWLRQZRXOGLQFOXGHDUFKLYDOUHVHDUFKDQGDILHOGH[DPLQDWLRQ 7KHSURSRVHGSURMHFWDUHDKRZHYHUKDVEHHQKLJKO\GHYHORSHGDQGLVSUHVHQWO\FRYHUHGZLWK DVSKDOWEXLOGLQJVRUILOOWKDWREVFXUHVWKHYLVLELOLW\RIRULJLQDOVXUIDFHVRLOVZKLFKQHJDWHVWKH IHDVLELOLW\RIDQDGHTXDWHVXUIDFHLQVSHFWLRQ ϯ ϮϮͲϬϬϵϰ )LHOGVWXG\PD\LQFOXGHEXWLVQRWOLPLWHGWRKDQGDXJHUVDPSOLQJVKRYHOWHVWXQLWVRU JHRDUFKDHRORJLFDODQDO\VHVDVZHOODVRWKHUFRPPRQPHWKRGVXVHGWRLGHQWLI\WKHSUHVHQFHRI EXULHGDUFKDHRORJLFDOUHVRXUFHV3OHDVHUHIHUWRWKHOLVWRIFRQVXOWDQWVZKRPHHWWKH6HFUHWDU\ RI,QWHULRU¶V6WDQGDUGVDWKWWSZZZFKULVLQIRRUJ :HUHFRPPHQGWKHOHDGDJHQF\FRQWDFWWKHORFDO1DWLYH$PHULFDQWULEHVUHJDUGLQJ WUDGLWLRQDOFXOWXUDODQGUHOLJLRXVKHULWDJHYDOXHV)RUDFRPSOHWHOLVWLQJRIWULEHVLQWKHYLFLQLW\RI WKHSURMHFWSOHDVHFRQWDFWWKH1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQDW ,IWKHSURSRVHGSURMHFWDUHDFRQWDLQVEXLOGLQJVRUVWUXFWXUHVWKDWPHHWWKHPLQLPXP DJHUHTXLUHPHQWSULRUWRFRPPHQFHPHQWRISURMHFWDFWLYLWLHVLWLVUHFRPPHQGHGWKDWWKLV UHVRXUFHEHDVVHVVHGE\DSURIHVVLRQDOIDPLOLDUZLWKWKHDUFKLWHFWXUHDQGKLVWRU\RI6DQ0DWHR &RXQW\3OHDVHUHIHUWRWKHOLVWRIFRQVXOWDQWVZKRPHHWWKH6HFUHWDU\RI,QWHULRU¶V6WDQGDUGVDW KWWSZZZFKULVLQIRRUJ 5HYLHZIRUSRVVLEOHKLVWRULFSHULRGEXLOGLQJVRUVWUXFWXUHVKDVLQFOXGHGRQO\WKRVH VRXUFHVOLVWHGLQWKHDWWDFKHGELEOLRJUDSK\DQGVKRXOGQRWEHFRQVLGHUHGFRPSUHKHQVLYH ,IDUFKDHRORJLFDOUHVRXUFHVDUHHQFRXQWHUHGGXULQJFRQVWUXFWLRQZRUNVKRXOGEH WHPSRUDULO\KDOWHGLQWKHYLFLQLW\RIWKHGLVFRYHUHGPDWHULDOVDQGZRUNHUVVKRXOGDYRLGDOWHULQJ WKHPDWHULDOVDQGWKHLUFRQWH[WXQWLODTXDOLILHGSURIHVVLRQDODUFKDHRORJLVWKDVHYDOXDWHGWKH VLWXDWLRQDQGSURYLGHGDSSURSULDWHUHFRPPHQGDWLRQV3URMHFWSHUVRQQHOVKRXOGQRWFROOHFW FXOWXUDOUHVRXUFHV1DWLYH$PHULFDQUHVRXUFHVLQFOXGHFKHUWRUREVLGLDQIODNHVSURMHFWLOHSRLQWV PRUWDUVDQGSHVWOHVDQGGDUNIULDEOHVRLOFRQWDLQLQJVKHOODQGERQHGLHWDU\GHEULVKHDW DIIHFWHGURFNRUKXPDQEXULDOV+LVWRULFSHULRGUHVRXUFHVLQFOXGHVWRQHRUDGREHIRXQGDWLRQVRU ZDOOVVWUXFWXUHVDQGUHPDLQVZLWKVTXDUHQDLOVDQGUHIXVHGHSRVLWVRUERWWOHGXPSVRIWHQ ORFDWHGLQROGZHOOVRUSULYLHV ,WLVUHFRPPHQGHGWKDWDQ\LGHQWLILHGFXOWXUDOUHVRXUFHVEHUHFRUGHGRQ'35 KLVWRULFUHVRXUFHUHFRUGDWLRQIRUPVDYDLODEOHRQOLQHIURPWKH2IILFHRI+LVWRULF3UHVHUYDWLRQ¶V ZHEVLWHKWWSVRKSSDUNVFDJRY"SDJHBLG 'XHWRSURFHVVLQJGHOD\VDQGRWKHUIDFWRUVQRWDOORIWKHKLVWRULFDOUHVRXUFHUHSRUWVDQG UHVRXUFHUHFRUGVWKDWKDYHEHHQVXEPLWWHGWRWKH2IILFHRI+LVWRULF3UHVHUYDWLRQDUHDYDLODEOH YLDWKLVUHFRUGVVHDUFK$GGLWLRQDOLQIRUPDWLRQPD\EHDYDLODEOHWKURXJKWKHIHGHUDOVWDWHDQG ORFDODJHQFLHVWKDWSURGXFHGRUSDLGIRUKLVWRULFDOUHVRXUFHPDQDJHPHQWZRUNLQWKHVHDUFK DUHD$GGLWLRQDOO\1DWLYH$PHULFDQWULEHVKDYHKLVWRULFDOUHVRXUFHLQIRUPDWLRQQRWLQWKH &DOLIRUQLD+LVWRULFDO5HVRXUFHV,QIRUPDWLRQ6\VWHP&+5,6,QYHQWRU\DQG\RXVKRXOGFRQWDFW ϰ ϮϮͲϬϬϵϰ WKH&DOLIRUQLD1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQIRULQIRUPDWLRQRQORFDOUHJLRQDOWULEDO FRQWDFWV 7KH&DOLIRUQLD2IILFHRI+LVWRULF3UHVHUYDWLRQ2+3FRQWUDFWVZLWKWKH&DOLIRUQLD +LVWRULFDO5HVRXUFHV,QIRUPDWLRQ6\VWHP¶V&+5,6UHJLRQDO,QIRUPDWLRQ&HQWHUV,&VWR PDLQWDLQLQIRUPDWLRQLQWKH&+5,6LQYHQWRU\DQGPDNHLWDYDLODEOHWRORFDOVWDWHDQGIHGHUDO DJHQFLHVFXOWXUDOUHVRXUFHSURIHVVLRQDOV1DWLYH$PHULFDQWULEHVUHVHDUFKHUVDQGWKHSXEOLF 5HFRPPHQGDWLRQVPDGHE\,&FRRUGLQDWRUVRUWKHLUVWDIIUHJDUGLQJWKHLQWHUSUHWDWLRQDQG DSSOLFDWLRQRIWKLVLQIRUPDWLRQDUHDGYLVRU\RQO\6XFKUHFRPPHQGDWLRQVGRQRWQHFHVVDULO\ UHSUHVHQWWKHHYDOXDWLRQRURSLQLRQRIWKH6WDWH+LVWRULF3UHVHUYDWLRQ2IILFHULQFDUU\LQJRXWWKH 2+3¶VUHJXODWRU\DXWKRULW\XQGHUIHGHUDODQGVWDWHODZ 7KDQN\RXIRUXVLQJRXUVHUYLFHV3OHDVHFRQWDFWWKLVRIILFHLI\RXKDYHDQ\ TXHVWLRQV 6LQFHUHO\ -LOOLDQ*XOGHQEUHLQ 5HVHDUFKHU ϱ ϮϮͲϬϬϵϰ /,7(5$785(5(9,(:(' ,QDGGLWLRQWRDUFKDHRORJLFDOPDSVDQGVLWHUHFRUGVRQILOHDWWKH1RUWKZHVW,QIRUPDWLRQ&HQWHU RIWKH+LVWRULFDO5HVRXUFHV,QIRUPDWLRQ6\VWHPWKHIROORZLQJOLWHUDWXUHZDVUHYLHZHG %DUURZV+HQU\'DQG/XWKHU$,QJHUVROO Memorial and Biographical History of the Coast Counties of Central California 7KUHH5RFNV5HVHDUFK6DQWD&UX]'LJLWDO5HSURGXFWLRQRI7KH/HZLV3XEOLVKLQJ &RPSDQ\&KLFDJR %RZPDQ-1 Adobe Houses in the San Francisco Bay Region,Q*HRORJLF*XLGHERRNRIWKH 6DQ)UDQFLVFR%D\&RXQWLHV%XOOHWLQ&DOLIRUQLD'LYLVLRQRI0LQHV)HUU\ %XLOGLQJ6DQ)UDQFLVFR&$ %UDEE(DUO()UHG$7D\ORUDQG*HRUJH30LOOHU Geologic, Scenic, and Historic Points of Interest in San Mateo County, California 0LVFHOODQHRXV,QYHVWLJDWLRQV6HULHV0DS,%'HSDUWPHQWRIWKH ,QWHULRU8QLWHG6WDWHV*HRORJLFDO6XUYH\:DVKLQJWRQ'& %URPILHOG'DYHQSRUW 2IILFLDO0DSRI6DQ0DWHR&RXQW\&DOLIRUQLD *HQHUDO/DQG2IILFH 6XUYH\3ODWIRU5DQFKR%XUL%XUL7RZQVKLS6RXWK5DQJH:HVW +HL]HU5REHUW)HGLWRU Local History Studies9RO³7KH&RVWDQRDQ,QGLDQV´&DOLIRUQLD+LVWRU\ &HQWHU 'H$Q]D&ROOHJH&XSHUWLQR&$ +HOOH\(-.5/DMRLH:(6SDQJOHDQG0/%ODLU Flatland Deposits of the San Francisco Bay Region - Their Geology and Engineering Properties, and Their Importance to Comprehensive Planning *HRORJLFDO6XUYH\3URIHVVLRQDO3DSHU8QLWHG6WDWHV*HRORJLFDO6XUYH\DQG 'HSDUWPHQWRI+RXVLQJDQG8UEDQ'HYHORSPHQW .URHEHU$/ Handbook of the Indians of California%XUHDXRI$PHULFDQ(WKQRORJ\%XOOHWLQ 6PLWKVRQLDQ,QVWLWXWLRQ:DVKLQJWRQ'&5HSULQWE\'RYHU3XEOLFDWLRQV,QF1HZ <RUN /HY\5LFKDUG &RVWDQRDQ,QCaliforniaHGLWHGE\5REHUW)+HL]HUSS+DQGERRNRI 1RUWK$PHULFDQ,QGLDQVYRO:LOOLDP&6WXUWHYDQWJHQHUDOHGLWRU6PLWKVRQLDQ ,QVWLWXWLRQ:DVKLQJWRQ'& 0LOOLNHQ5DQGDOO A Time of Little Choice: The Disintegration of Tribal Culture in the San Francisco Bay Area 1769-1810%DOOHQD3UHVV$QWKURSRORJLFDO3DSHUV1R0HQOR3DUN &$ ϲ ϮϮͲϬϬϵϰ 0\HUV:LOOLDP$HGLWRU Historic Civil Engineering Landmarks of San Francisco and Northern California 3UHSDUHGE\7KH+LVWRU\DQG+HULWDJH&RPPLWWHH6DQ)UDQFLVFR6HFWLRQ$PHULFDQ 6RFLHW\RI&LYLO(QJLQHHUV3DFLILF*DVDQG(OHFWULF&RPSDQ\6DQ)UDQFLVFR&$ 1HOVRQ1& Shellmounds of the San Francisco Bay Region8QLYHUVLW\RI&DOLIRUQLD 3XEOLFDWLRQVLQ$PHULFDQ$UFKDHRORJ\DQG(WKQRORJ\%HUNHOH\ 5HSULQWE\.UDXV5HSULQW&RUSRUDWLRQ1HZ<RUN 1LFKROV'RQDOG5DQG1DQF\$:ULJKW 3UHOLPLQDU\0DSRI+LVWRULF0DUJLQVRI0DUVKODQG6DQ)UDQFLVFR%D\&DOLIRUQLD 86*HRORJLFDO6XUYH\2SHQ)LOH0DS86'HSDUWPHQWRIWKH,QWHULRU*HRORJLFDO 6XUYH\LQFRRSHUDWLRQZLWKWKH86'HSDUWPHQWRI+RXVLQJDQG8UEDQ 'HYHORSPHQW:DVKLQJWRQ'& 3RVWHO0LWFKHOO3 San Mateo, A Centennial History. 6FRWWZDOO$VVRFLDWHV6DQ)UDQFLVFR&$ 6DQ0DWHR&RXQW\+LVWRULF5HVRXUFHV$GYLVRU\%RDUG 1984 San Mateo County: Its History and Heritage6HFRQG(GLWLRQ'LYLVLRQRI 3ODQQLQJ DQG'HYHORSPHQW'HSDUWPHQWRI(QYLURQPHQWDO0DQDJHPHQW 6WDWHRI&DOLIRUQLD'HSDUWPHQWRI3DUNVDQG5HFUHDWLRQ California Inventory of Historic Resources6WDWHRI&DOLIRUQLD'HSDUWPHQWRI 3DUNVDQG5HFUHDWLRQ6DFUDPHQWR 6WDWHRI&DOLIRUQLD'HSDUWPHQWRI3DUNVDQG5HFUHDWLRQDQG2IILFHRI+LVWRULF3UHVHUYDWLRQ Five Views: An Ethnic Sites Survey for California6WDWHRI&DOLIRUQLD'HSDUWPHQW RI3DUNVDQG5HFUHDWLRQDQG2IILFHRI+LVWRULF3UHVHUYDWLRQ6DFUDPHQWR 6WDWHRI&DOLIRUQLD2IILFHRI+LVWRULF3UHVHUYDWLRQ Built Environment Resources Directory/LVWLQJE\&LW\WKURXJK6HSWHPEHU 6WDWHRI&DOLIRUQLD2IILFHRI+LVWRULF3UHVHUYDWLRQ6DFUDPHQWR :RRGEULGJH6DOO\% California Architecture: Historic American Buildings Survey&KURQLFOH%RRNV 6DQ)UDQFLVFR&$ :RUNV3URJUHVV$GPLQLVWUDWLRQ The WPA Guide to California5HSULQWE\3DQWKHRQ%RRNV1HZ<RUN2ULJLQDOO\ SXEOLVKHGDV&DOLIRUQLD$*XLGHWRWKH*ROGHQ6WDWHLQE\%RRNV,QF GLVWULEXWHGE\+DVWLQJV+RXVH3XEOLVKHUV1HZ<RUN 1RWHWKDWWKH2IILFHRI+LVWRULF3UHVHUYDWLRQ¶VHistoric Properties DirectoryLQFOXGHV1DWLRQDO 5HJLVWHU6WDWH5HJLVWHUHG/DQGPDUNV&DOLIRUQLD3RLQWVRI+LVWRULFDO,QWHUHVWDQGWKH&DOLIRUQLD 5HJLVWHURI+LVWRULFDO5HVRXUFHVDVZHOODV&HUWLILHG/RFDO*RYHUQPHQWVXUYH\VWKDWKDYH XQGHUJRQH6HFWLRQUHYLHZ Report ListReport No.YearTitleAffiliationAuthor(s)Other IDsNWIC File # 22-0094 800 Dubuque Ave, South SFS-0065291984Subsurface Archaeological Testing of the Dubuque Packing Plant Site on Dubuque Avenue in the City of South San Francisco, County of San MateoArchaeological Resource ManagementRobert CartierS-0179931995Cultural Resources Inventory Report for the Proposed Mojave Northward Expansion ProjectWoodward-Clyde ConsultantsBrian Hatoff, Barb Voss, Sharon Waechter, Stephen Wee, and Vance BenteS-017993a1995Proposed Mojave Northward Expansion Project: Appendix A - Native American ConsultationWoodward-Clyde ConsultantsS-017993b1995Proposed Mojave Northward Expansion Project: Appendix B - Looping Segments - Class 1Woodward-Clyde ConsultantsS-017993c1995Proposed Mojave Northward Expansion Project: Appendix C -Monitoring and Emergency Discovery PlanWoodward-Clyde ConsultantsS-017993d1995Proposed Mojave Northward Expansion Project: Appendix D - General Construction InformationWoodward-Clyde ConsultantsS-017993e1995Proposed Mojave Northward Expansion Project: Appendix E - Archaeological Site RecordsWoodward-Clyde ConsultantsPage 1 of 7NWIC 7/22/2022 11:51:36 AM Report ListReport No.YearTitleAffiliationAuthor(s)Other IDsNWIC File # 22-0094 800 Dubuque Ave, South SFS-017993f1995Proposed Mojave Northward Expansion Project: Appendix F - Historic Features Evaluation FormsWoodward-Clyde ConsultantsS-017993g1995Proposed Mojave Northward Expansion Project: Appendix G - Railroad Crossing Evaluation FormsWoodward-Clyde ConsultantsS-017993h1995Proposed Mojave Northward Expansion Project: Appendix H - Crossing Diagrams and Plan View MapsWoodward Clyde ConsultantsS-017993I1995Proposed Mojave Northward Expansion Project: Appendix I - Railroad Depot NRHP Nomination Forms and Related RecordsWoodward-Clyde ConsultantsS-017993j1995Proposed Mojave Northward Expansion Project: Appendix J - Looping Segment and Compressor Station Site RecordsWoodward-Clyde ConsultantsS-017993k1995Proposed Mojave Northward Expansion Project: Appendix K - Historic Site Records / Isolate FormsWoodward-Clyde ConsultantsS-017993l1995Proposed Mojave Northward Expansion Project: Appendix L - PhotodocumentationWoodward-Clyde ConsultantsS-017993m1995Proposed Mojave Northward Expansion Project: Appendix M - Curricula Vitae of Key PreparersWoodward-Clyde ConsultantsPage 2 of 7NWIC 7/22/2022 11:51:36 AM Report ListReport No.YearTitleAffiliationAuthor(s)Other IDsNWIC File # 22-0094 800 Dubuque Ave, South SFS-0260452000Cultural Resources Reconnaissance Survey and Inventory Report for the Metromedia Fiberoptic Cable Project, San Francisco Bay Area and Los Angeles Basin NetworksMooney & AssociatesRichard Carrico, Theodore Cooley, and William EckhardtPage 3 of 7NWIC 7/22/2022 11:51:37 AM Report ListReport No.YearTitleAffiliationAuthor(s)Other IDsNWIC File # 22-0094 800 Dubuque Ave, South SFS-0296572002Archaeological Inventory for the Caltrain Electrification Program Alternative in San Francisco, San Mateo, and Santa Clara Counties, CaliforniaFar Western Anthropological Research Group, Inc.Wendy J. Nelson, Tammara Norton, Larry Chiea, and Reinhard PribishOHP PRN - FTA021021A; Voided - S-37863; Voided - S-42672; Voided - S-43525S-029657a2002Finding of No Adverse Effect, Caltrain Electrification Program, San Francisco, San Mateo, and Santa Clara Counties, CaliforniaJRP Historical Consulting ServicesRand F. HerbertS-029657b2002Historic Property Survey for the Proposed Caltrain Electrification Program, San Francisco, San Mateo, and Santa Clara Counties, CaliforniaParsons; JRP Historical Consulting Services; Far Western Anthropological Research Group, Inc.S-029657c2002FTA021021A; Caltrain Electrification Program, San Francisco, San Mateo, and Santa Clara CountiesOffice of Historic PreservationKnox MellonS-029657d2003Final Finding of Effect Amendment, Caltrain Electrification Project, San Francisco, San Mateo, and Santa Clara Counties, CaliforniaJRP Historical Consulting ServicesMeta BunsePage 4 of 7NWIC 7/22/2022 11:51:37 AM Report ListReport No.YearTitleAffiliationAuthor(s)Other IDsNWIC File # 22-0094 800 Dubuque Ave, South SFS-029657e2001Draft Finding of No Adverse Effect, Caltrain Electrification Program, San Francisco, San Mateo, and Santa Clara Counties, CaliforniaJRP Historical Consulting ServicesRand F. HerbertS-029657f2008Cultural Resources Addendum for the Caltrain Electrification Program Alternative: San Francisco, San Mateo, and Santa Clara Counties, CaliforniaFar Western Anthropological Research Group, Inc.Sharon A. Waechter, Jack Meyer, and Laura Leach-PalmS-029657g2008Addendum Finding of Effect, Caltrain Electrification Program, San Francisco to San Jose (MP 0.0 to 52.0); San Francisco, San Mateo, and Santa Clara Counties, CaliforniaJRP Historical Consulting, LLCMeta BunseS-029657h2002Inventory and Evaluation of Historic Resources, Caltrain Electrification Program, San Francisco to Gilroy (MP 0.0 to 77.4) (Draft)JRP Historical Consulting ServicesPage 5 of 7NWIC 7/22/2022 11:51:37 AM Report ListReport No.YearTitleAffiliationAuthor(s)Other IDsNWIC File # 22-0094 800 Dubuque Ave, South SFS-0487382011California High-Speed Train Project, Environmental Impact Report/Environmental Impact Statement, San Francisco to San Jose Section, Archaeological Survey Report, Technical Report [Draft]PBS&JDenise Jurich and Amber GradyPage 6 of 7NWIC 7/22/2022 11:51:37 AM Report ListReport No.YearTitleAffiliationAuthor(s)Other IDsNWIC File # 22-0094 800 Dubuque Ave, South SFS-048738a2011California High-Speed Train Project, Environmental Impact Report/Environmental Impact Statement, San Francisco to San Jose Section, Historic Architectural Survey Report, Technical Report [Draft]PBS&JAmber Grady and Richard BrandiPage 7 of 7NWIC 7/22/2022 11:51:37 AM STATE OF CALIFORNIA Gavin Newsom, Governor NATIVE AMERICAN HERITAGE COMMISSION Page 1 of 2 August 25, 2022 Rebecca Auld Lamphier-Gregory Via Email to:rauld@lamphier-gregory.com Re: Native American Consultation, Pursuant to Senate Bill 18 (SB18), Government Codes §65352.3 and §65352.4, as well as Assembly Bill 52 (AB52), Public Resources Codes §21080.1, §21080.3.1 and §21080.3.2, 800 Dubuque Ave Project, San Mateo County Dear Ms. Auld: Attached is a consultation list of tribes with traditional lands or cultural places located within the boundaries of the above referenced counties or projects. Government Codes §65352.3 and §65352.4 require local governments to consult with California Native American tribes identified by the Native American Heritage Commission (NAHC) for the purpose of avoiding, protecting, and/or mitigating impacts to cultural places when creating or amending General Plans, Specific Plans and Community Plans. Public Resources Codes §21080.3.1 and §21080.3.2 requires public agencies to consult with California Native American tribes identified by the Native American Heritage Commission (NAHC) for the purpose of avoiding, protecting, and/or mitigating impacts to tribal cultural resources as defined, for California Environmental Quality Act (CEQA) projects. The law does not preclude local governments and agencies from initiating consultation with the tribes that are culturally and traditionally affiliated within your jurisdiction. The NAHC believes that this is the best practice to ensure that tribes are consulted commensurate with the intent of the law. Best practice for the AB52 process and in accordance with Public Resources Code §21080.3.1(d), is to do the following: Within 14 days of determining that an application for a project is complete or a decision by a public agency to undertake a project, the lead agency shall provide formal notification to the designated contact of, or a tribal representative of, traditionally and culturally affiliated California Native American tribes that have requested notice, which shall be accomplished by means of at least one written notification that includes a brief description of the proposed project and its location, the lead agency contact information, and a notification that the California Native American tribe has 30 days to request consultation pursuant to this section. The NAHC also recommends, but does not require that lead agencies include in their notification letters, information regarding any cultural resources assessment that has been completed on the area of potential affect (APE), such as: S A R L CHAIRPERSON Laura Miranda Luiseño VICE CHAIRPERSON Reginald Pagaling Chumash PARLIAMENTARIAN Russell Attebery Karuk SECRETARY Sara Dutschke Miwok COMMISSIONER William Mungary Paiute/White Mountain Apache COMMISSIONER Isaac Bojorquez Ohlone-Costanoan COMMISSIONER Buffy McQuillen Yokayo Pomo, Yuki, Nomlaki COMMISSIONER Wayne Nelson Luiseño COMMISSIONER Stanley Rodriguez Kumeyaay EXECUTIVE SECRETARY Raymond C. Hitchcock Miwok/Nisenan NAHC HEADQUARTERS 1550 Harbor Boulevard Suite 100 West Sacramento, California 95691 (916) 373-3710 nahc@nahc.ca.gov NAHC.ca.gov Page 2 of 2 1. The results of any record search that may have been conducted at an Information Center of the California Historical Resources Information System (CHRIS), including, but not limited to: x A listing of any and all known cultural resources have already been recorded on or adjacent to the APE, such as known archaeological sites; x Copies of any and all cultural resource records and study reports that may have been provided by the Information Center as part of the records search response; x Whether the records search indicates a low, moderate or high probability that unrecorded cultural resources are located in the APE; and x If a survey is recommended by the Information Center to determine whether previously unrecorded cultural resources are present. 2. The results of any archaeological inventory survey that was conducted, including: x Any report that may contain site forms, site significance, and suggested mitigation measures. All information regarding site locations, Native American human remains, and associated funerary objects should be in a separate confidential addendum, and not be made available for public disclosure in accordance with Government Code Section 6254.10. 3. The result of the Sacred Lands File (SFL) check conducted through the Native American Heritage Commission was negative. 4. Any ethnographic studies conducted for any area including all or part of the potential APE; and 5. Any geotechnical reports regarding all or part of the potential APE. Lead agencies should be aware that records maintained by the NAHC and CHRIS is not exhaustive, and a negative response to these searches does not preclude the existence of a tribal cultural resource. A tribe may be the only source of information regarding the existence of a tribal cultural resource. This information will aid tribes in determining whether to request formal consultation. In the event, that they do, having the information beforehand well help to facilitate the consultation process. If you receive notification of change of addresses and phone numbers from tribes, please notify the NAHC. With your assistance we can assure that our consultation list remains current. If you have any questions, please contact me at my email address: Cody.Campagne@nahc.ca.gov. Sincerely, Cody Campagne Cultural Resources Analyst Attachment Amah MutsunTribal Band of Mission San Juan Bautista Irene Zwierlein, Chairperson 3030 Soda Bay Road Lakeport, CA, 95453 Phone: (650) 851 - 7489 Fax: (650) 332-1526 amahmutsuntribal@gmail.com Costanoan Costanoan Rumsen Carmel Tribe Tony Cerda, Chairperson 244 E. 1st Street Pomona, CA, 91766 Phone: (909) 629 - 6081 Fax: (909) 524-8041 rumsen@aol.com Costanoan Indian Canyon Mutsun Band of Costanoan Ann Marie Sayers, Chairperson P.O. Box 28 Hollister, CA, 95024 Phone: (831) 637 - 4238 ams@indiancanyons.org Costanoan Indian Canyon Mutsun Band of Costanoan Kanyon Sayers-Roods, MLD Contact 1615 Pearson Court San Jose, CA, 95122 Phone: (408) 673 - 0626 kanyon@kanyonkonsulting.com Costanoan Muwekma Ohlone Indian Tribe of the SF Bay Area Charlene Nijmeh, Chairperson 20885 Redwood Road, Suite 232 Castro Valley, CA, 94546 Phone: (408) 464 - 2892 cnijmeh@muwekma.org Costanoan Muwekma Ohlone Indian Tribe of the SF Bay Area Monica Arellano, Vice Chairwoman 20885 Redwood Road, Suite 232 Castro Valley, CA, 94546 Phone: (408) 205 - 9714 marellano@muwekma.org Costanoan The Ohlone Indian Tribe Andrew Galvan, P.O. Box 3388 Fremont, CA, 94539 Phone: (510) 882 - 0527 Fax: (510) 687-9393 chochenyo@AOL.com Bay Miwok Ohlone Patwin Plains Miwok Wuksache Indian Tribe/Eshom Valley Band Kenneth Woodrow, Chairperson 1179 Rock Haven Ct. Salinas, CA, 93906 Phone: (831) 443 - 9702 kwood8934@aol.com Foothill Yokut Mono 1 of 1 This list is current only as of the date of this document and is based on the information available to the Commission on the date it was produced. Distribution of this list does not relieve any person of statutory responsibility as defined in Section 7050.5 of the Health and Safety Code, Section 5097.94 of the Public Resources Code and Section 5097.98 of the Public Resources Code. This list is applicable only for consultation with Native American tribes under Government Code Sections 65352.3, 65352.4 et seq. and Public Resources Code Sections 21080.3.1 for the proposed 800 Dubuque Ave Project, San Mateo County. PROJ-2022- 005001 08/25/2022 07:35 AM Native American Heritage Commission Tribal Consultation List San Mateo County 8/25/2022 (1(5*<&$/&8/$7,216 #66#%*/'06% WRWKH 'XEXTXH$YHQXH3URMHFW,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ To support the Energy Analysis for the following project: 800 Dubuque Construction Equipment/Vehicles # of Vehicles Hrs per Day Horse- power Load Factor Days in Phase Fuel Used (gallons) Demolition Rubber Tired Dozers 1 8 247 0.4 120 5,017 Air Compressors 1 8 78 0.48 120 2,113 Concrete Saws 1 8 81 0.73 120 3,338 Excavators 3 8 153 0.38 120 8,858 Generator Sets 1 8 84 0.74 120 3,509 Plate Compactors 1 8 8 0.43 120 194 Sweepers/Scrubbers 1 4 64 0.46 120 831 Tractors/Loaders/Backhoes 3 8 97 0.37 120 6,078 Grading / Excavation Bore/Drill Rigs 5 8 221 0.5 234 54,713 Cranes 1 8 231 0.29 234 6,634 Excavators 3 8 153 0.38 234 17,273 Graders 1 8 187 0.41 234 7,593 Pumps 2 8 84 0.74 234 13,684 Pumps 1 24 84 0.74 234 20,527 Rollers 1 4 80 0.38 234 1,673 Rubber Tired Dozers 1 8 247 0.4 234 9,784 Sweepers/Scrubbers 1 4 64 0.46 234 1,620 Tractors/Loaders/Backhoes 2 8 97 0.37 234 7,901 Building Construction Aerial Lifts 2 8 63 0.31 563 10,344 Aerial Lifts 24 8 63 0.31 563 124,134 Air Compressors 1 8 78 0.48 563 9,915 Cranes 1 3.3 231 0.29 563 6,584 Cranes 2 8 231 0.29 563 31,922 Forklifts 1 8 89 0.2 563 4,714 Generator Sets 1 8 84 0.74 563 16,462 Sweepers/Scrubbers 1 4 64 0.46 563 3,898 Tractors/Loaders/Backhoes 1 4 97 0.37 563 4,752 Welders 12 8 46 0.45 563 65,785 Building - Interior / Architectural Coating Air Compressors 1 6 78 0.48 130 1,717 Paving Aerial Lifts 1 8 63 0.31 181 1,663 Pavers 1 8 130 0.42 181 4,182 Paving Equipment 2 8 132 0.36 181 7,280 Plate Compactors 1 8 8 0.43 181 293 Rollers 1 8 80 0.38 181 2,588 Rubber Tired Dozers 1 4 247 0.4 181 3,784 Sweepers/Scrubbers 1 4 64 0.46 181 1,253 Tractors/Loaders/Backhoes 2 8 97 0.37 181 6,112 Total Fuel Used for Construction Equipment/Vehicles 478,724 (diesel) Compression-Ignition Engine Brake-Specific Fuel Consumption (BSFC) Factors [1] used in the above calculations are (in gallons per horsepower-hour/BSFC) 0.0588 <100 horsepower Construction Energy Use Energy Calculations Page 1 of 5 0.0529 >100 horsepower Worker Trips Phase MPG [2] Trips Trip Length (miles) Total Miles per Day Days in Phase Fuel Used (gallons) Demolition 24 28 10.8 302.4 120 1,512 Grading Phase 24 43 10.8 464.4 234 4,528 Building Construction 24 557 10.8 6015.6 563 141,116 Paving 24 20 10.8 216 181 1,629 Building Interior 24 111 10.8 1198.8 130 6,494 Total Fuel Used for Construction Worker Trips 155,278 (gasoline) Construction Energy Use, Continued Vendor Trips Phase MPG [2] Trips Trip Length (miles) Total Miles per Day Days in Phase Fuel Used (gallons) Demolition 7.4 0 7.3 0 120 0 Grading Phase 7.4 0 7.3 0 234 0 Building Construction 7.4 252 7.3 1839.6 563 139,959 Paving 7.4 0 7.3 0 181 0 Building Interior 7.4 0 7.3 0 130 0 Total Fuel Used for Vendor Trips 139,959 (diesel) Hauling Trips Phase MPG [2] Trips in Phase Trip Length (miles) Total Miles in Phase Fuel Used (gallons) Demolition 7.4 539.4 20 10788 1,458 Grading Phase 7.4 41375 20 827500 111,824 Building Construction 7.4 16800 20 336000 45,405 Paving 7.4 267 20 5340 722 Building Interior 7.4 0 20 0 0 Total Fuel Used for Hauling Trips 159,409 (diesel) Fuel Use Converted to MMBtu Source Fuel Converted to Energy Use Diesel [3]106,895 MMBtu Gasoline [4]17,047 MMBtu Total Energy Use from Construction Fuel 123,942 MMBtu Sum of above 155,278 137,381 109,786 Total Construction Fuel Use (gallons) Conversion Factor Btu/gallon 778,092 Energy Calculations Page 2 of 5 Operational Vehicular Fuel Use Gross Annual VMT 12,405,925 Fleet Class Fleet Mix VMT per Class Fuel Ecomony [5] Fuel Consumption (gallons) Light Duty Auto (LDA) 0.411757 5108226.5 30.9 165314.77 Light Duty Truck 1 (LDT1) 0.041436 514051.91 26.63 19303.49 Light Duty Truck 2 (LDT2) 0.297526 3691085.2 24.36 151522.38 Medium Duty Vehicle (MDV) 0.170986 2121239.5 20.2 105011.86 Motorcycle (MCY) 0.024361 302220.74 37.06 8154.90 Total Gasoline 449,307 Light Heavy Duty 1 (LHD1) 0.030624 379919.05 18.23 20840.32 gallons Light Heavy Duty 2 (LHD2) 0.007023 87126.811 16.24 5364.95 Medium Heavy Duty (MHD) 0.00842 104457.89 9.43 11077.19 Heavy Heavy Duty (HHD) 0.002436 30220.833 6.42 4707.29 Other Bus (OBUS) 0.002246 27863.708 8.26 3373.33 Urban Bus (UBUS) 0.000679 8423.6231 5.17 1629.33 School Bus (SBUS) 0.000402 4987.1819 7.25 687.89 Motorhome (MH ) 0.002104 26102.066 9.91 2633.91 Total Diesel 50,314 gallons Note that the above numbers represent gross fuel consumption. Source Diesel 50,314 [3] 6,912 MMBtu Gasoline 449,307 [4] 49,328 MMBtu Total Energy Use from Operational Fuel 56,240 MMBtu Operational Built Environment Type of Energy Annual Usage Units Converted to MMBtu Electricity 1.02E+07 kWh 34697 Natural Gas 2.21E+07 kBtu 22113 *Note that because this analysis was performed prior to adoption of the General Plan 2040, some natural gas usage was assumed in the CalEEMod report. Electricity equivalency conversion does not change conclusions. Sum of above Total Annual Operational Energy Use 113,050 MMBtu Operational Energy Use 137,381 109,786 Fuel Converted to Energy Use Total Fuel Use (gallons) Conversion Factor Btu/gallon Energy Calculations Page 3 of 5 Net Operational Vehicular Fuel Energy Use Existing Use VMT: 1,786,678 Resultant Net Annual Gasoline Use: 384,599 gallons Resultant Net Annual Diesel Use: 43,068 gallons Source Diesel 43,068 [3] 5,917 MMBtu Gasoline 384,599 [4] 42,224 MMBtu Total Energy Use from Net Operational Fuel 48,140 MMBtu Existing and Net Operational Built Environment Net Type of Energy Annual Usage Units Converted to MMBtu Energy Use in MMBtu Electricity 8.44E+05 kWh 2880 31817 Natural Gas 2.79E+06 kBtu 2791.03 19322 Total 5671 51139 Sum of above Total Net Annual Operational Energy Use 99,279 MMBtu Existing and Net Energy Use To determine the net increase in fuel usage, fuel usage of the existing uses at the site can be subtracted from the gross consumption above. The following number also incorproates the TDM reduction identified in the Operational calculations. Existing Net Fuel Use (gallons) Conversion Factor Fuel Converted to Energy UseBtu/gallon 137,381 109,786 Energy Calculations Page 4 of 5 Sources Unless otherwise noted, information in these calculations is from the project-specific Air Quality/Emissions Assessment for the project, including CalEEMod output tables. [1] United States Environmental Protection Agency. 2018. Exhaust and Crankcase Emission Factors for Nonroad Compression-Ignition Engines in MOVES2014b . July 2018. Available at: https://nepis.epa.gov/Exe/ZyPDF.cgi?Dockey=P100UXEN.pdf. [2] United States Department of Transportation, Bureau of Transportation Statistics. 2018. National Transportation Statistics 2018 . Available at: https://www.bts.gov/sites/bts.dot.gov/files/docs/browse-statistical-products-anddata/national- transportation-statistics/223001/ntsentire2018q4.pdf. https://www.eia.gov/totalenergy/data/monthly/archive/00352205.pdf [4] California Air Resources Board, CA-GREET 2.0 Supplemental Document and Tables of Changes, Appendix C, Supplement to the LCFS CA-GREET 2.0 Model, 12/15/2014 , page C-24, Table 10. Available at: https://ww2.arb.ca.gov/sites/default/files/barcu/regact/2015/lcfs2015/lcfs15appc.pdf [5] California Air Resources Board (CARB), EMFAC2021 v1.0.0., 2021. Available at https://ww2.arb.ca.gov/our- work/programs/mobile-source-emissions-inventory/msei-modeling-tools-emfac-software-and [6] Anticipated TDM reduction information is from the the project-specific CEQA Transportation Analysis. Acronyms used include: Btu = British Thermal Units hrs = hours kBtu = Thousand British Thermal Units kWH = kilowatt hours MMBtu = Million British Thermal Units MPG = miles per gallon TDM = Transportation Demand Management VMT = vehicle miles traveled Energy Calculations Page 5 of 5 75$163257$7,21$1$/<6,6 #66#%*/'06& WRWKH 'XEXTXH$YHQXH3URMHFW,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ 800 Dubuque Avenue CEQA Transportation Analysis Prepared for: Lamphier-Gregory March 24, 2023 Hexagon Transportation Consultants, Inc. Hexagon Office: 4 North Second Street, Suite 400 San Jose, CA 95113 Phone: 408.971.6100 Hexagon Job Number: 22TD03 Client Name: Lamphier-Gregory 800 Dubuque Avenue – CEQA Transportation Analysis i | Page Executive Summary As required by the California Environmental Quality Act (CEQA), this report includes an analysis of Vehicles Miles Travelled (VMT) and an evaluation of potential impacts to transit, pedestrian, and bicycle facilities for the proposed redevelopment of 800 Dubuque Avenue in South San Francisco to a higher density Office/Research & Development uses. The project is presumed to have a less than significant impact on VMT as it is located less than ½ mile from the South San Francisco Caltrain Station. The project is proposing an FAR of 3.3, would not exceed the required number of parking spaces and is consistent with the land use designation under the City’s 2040 General Plan. The project would also implement a Transportation Demand Management (TDM) program as required by the Municipal Code that requires all non-residential projects that would generate more than 100 daily trips to implement various trip reduction measures to reduce single occupancy vehicle trips (SOV) and achieve a minimum 50% alternative mode use. Given its proximity to the Caltrain station, the project is expected to achieve higher than the minimum 50% alternative mode use. Therefore, a detailed VMT analysis is not required. The project would not remove any pedestrian facilities, nor would it conflict with any adopted plans or policies for new pedestrian facilities. Accordingly, the project would have no significant impact on pedestrian facilities. The project would provide on-site bicycle parking facilities. The project would not remove any bicycle facilities, nor would it conflict with any adopted plans or policies for new bicycle facilities. Accordingly, the project would have no significant impact on bicycle facilities. The project is expected to add a high number of new transit riders. However, given the extensive services available, the new riders could be accommodated. The project would therefore have no significant impact on transit service. Adequate corner sight distance should be provided for drivers exiting both project driveways. The project would underground 462 linear feet of electrical line and clear all line-of-sight obstructions along the project’s frontage on Dubuque Avenue. The project shall demonstrate to the satisfaction of the City that the site sight distance is adequate at both project driveways. With the provision of adequate sight distance at both project driveways, the project’s impact on safety would be reduced to less than significant. 800 Dubuque Avenue – CEQA Transportation Analysis ii | Page The project would not reroute or change any of the City streets in its vicinity that would impact emergency vehicle access to properties along Dubuque Avenue. The proposed site access roadways would accommodate emergency vehicles. Thus, the project would not result in any emergency vehicle access impact that would be considered significant. 800 Dubuque Avenue – Transportation Analysis 1 | Page Project Description The purpose of this report is to analyze the transportation-related impacts of the proposed Office/Research & Development project at 800 Dubuque Avenue in South San Francisco, as required by the California Environmental Quality Act (CEQA). The proposed project would involve demolition of the three existing buildings located on the 800 to 890 Dubuque Avenue parcels and construction of three new office/research and development (R&D) buildings. The project would be comprised of three buildings: the 10-story North building, the 6-story South building, and the 9-story West building, for a total of up to approximately 900,000 square feet of floor area. The north building would be the tallest at approximately 195 feet (including the mechanical penthouse). The buildings would be connected by a two-story podium that provides open space and an approximately 7,200 square foot fitness center. The center of the site would contain a plaza and courtyard lined with on-site food/beverage and tenant amenity uses totaling approximately 6,600 square feet, as well as an approximately 7,500 square foot event center. The project is intended to be a mix of R&D space and offices. The west building would be oriented along Dubuque Avenue, and the north and south buildings would be oriented along the internal roadways. The project is located one-quarter mile north of the South San Francisco Caltrain station. The development is consistent with the land use designation in the City’s General Plan, Shape SSF 2040, and related zoning, which plan for higher-density, transit- oriented uses at and around the project site. Structured parking would be provided in four stories below grade, with approximately 1,335 parking spaces. Vehicular access to the project site would be provided via two driveways on Dubuque Avenue. This report includes an analysis of Vehicle Miles Travelled (VMT), potential impacts to pedestrian and bicycle facilities and transit services, and the project’s safety and emergency access. 800 Dubuque Avenue – Transportation Analysis 2 | Page CEQA Analysis VMT Analysis Pursuant to SB 743, the CEQA 2019 Update Guidelines Section 15064.3, subdivision (b) states that vehicle miles travelled (VMT) will be the metric in analyzing transportation impacts for land use projects for California Environmental Quality Act (CEQA) purposes. The City of South San Francisco has adopted certain thresholds of significance based on the project type to guide in determining when a project will have a significant transportation impact. For non-retail land use projects, a significant impact would occur if the VMT would be above the threshold, which is defined as 15% below the regional average. The City of South San Francisco provides screening criteria for development projects. The criteria are based on the type of project, characteristics, and/or location. If a project meets the City’s screening criteria, the project is expected to result in less-than-significant impacts, and a detailed CEQA VMT analysis is not required. The City’s policy states that projects within ½ mile of an existing or planned high- quality transit corridor or major transit station should be presumed to have a less-than-significant impact on VMT. However, this presumption would not apply if the project FAR is less than 0.75, includes parking that is higher than required by the City, is inconsistent with the City’s General Plan, or replaces affordable residential units with a smaller number of market-rate units. The project site is located less than one- quarter mile from the South San Francisco Caltrain Station. The project is proposing an FAR of 3.3, would not exceed the required number of parking spaces, and is consistent with the land use proposed in the City’s General Plan, Shape SSF 2040. Therefore, a detailed VMT analysis is not required. The project would also implement a Transportation Demand Management (TDM) program as required by the Municipal Code, which requires all new developments to implement various trip reduction measures to reduce single occupancy vehicle trips (SOV) based on their anticipated effect on the City’s transportation network. The project would be categorized as a Tier 4 development, which includes all office and R&D projects with at least 400,000 s.f. of gross floor area and requires a minimum 50% alternative mode use. The project would implement TDM measures to encourage employees and visitors to use transit, given its proximity to the Caltrain station. Cumulative Impact Analysis According to the Governor’s Office of Planning and Research (OPR), a finding of a less-than-significant project impact based on project screening criteria would imply a less than significant cumulative impact. The project aligns with the land use controls under the City’s General Plan, Shape SSF 2040, which plans for higher-density, transit-oriented uses at and around the project site: re-imagining the area as a new urban corridor accessible to pedestrians, bicyclists, and transit riders. Therefore, the project would be considered as part of the cumulative solution to meet the General Plan’s long-range transportation goals and would result in a less-than-significant cumulative impact. Pedestrians, Bicycles and Transit Pedestrian Facilities Sidewalks are provided on the east side of Dubuque Avenue from Oyster Point Boulevard to Grand Avenue, and along Grand Avenue from Gateway Boulevard to Airport Boulevard. The signalized intersections at Dubuque Avenue/Oyster Point Boulevard and Dubuque Avenue/Grand Avenue provide crosswalks, curb ramps, and pedestrian-actuated pedestrian-crossing phases on all approaches. The project would reconstruct the sidewalk along its frontage on Dubuque Avenue by moving it away from the curb and configuring it in a winding path through planting and trees to provide enhanced comfort and safety for pedestrians (see Figure 1). Striped crosswalks would be provided across the north and the south driveways to provide connections to existing sidewalks to the north and south of the project site. 800 Dubuque Avenue – Transportation Analysis 3 | Page As part of the South San Francisco Caltrain Reconstruction Project, a new pedestrian/bicycle undercrossing was constructed under the Caltrain tracks that provides a direct connection for pedestrians and bicyclists between areas to the west (Airport Boulevard) and east (Poletti Way and East Grand Avenue) of the Caltrain tracks. This undercrossing also provides a connection to the new Caltrain station platform. The South San Francisco Caltrain station is currently pedestrian-accessible from Dubuque Avenue via a staircase located at the northwest corner of the signalized intersection at Dubuque Avenue and Grand Avenue. However, no ADA access is provided to the Caltrain station from Dubuque Avenue. The 580 Dubuque Avenue project, which is located adjacent to the Caltrain station parking lot is currently under development and is conditioned to provide a pedestrian route, including ADA access, to the Caltrain station. The project is well situated to take advantage of the existing and planned pedestrian facilities in the immediate vicinity. The existing network of sidewalks and crosswalks, together with the planned addition of ADA access to the Caltrain station from Dubuque Avenue (via the 580 Dubuque Avenue project), provide good connectivity and safe routes to transit services and other points of interest in the downtown area. The project would not remove any pedestrian facilities, nor would it conflict with the Active South City, the City of South San Francisco’s Bicycle and Pedestrian Master Plans. Accordingly, the project would have no significant impact on pedestrian facilities. Bicycle Facilities Bicycle access to the project site is currently limited as there are no bike lanes on Dubuque Avenue. As stated above, the new pedestrian/bicycle undercrossing provides bicycle access between East Grand Avenue/Poletti Way and Airport Boulevard, with direct access to the Caltrain station platform. Bicycle access between the project site and the South San Francisco Caltrain station would be provided via the existing Caltrain Station access driveway on Dubuque Avenue. Other existing bicycle facilities in the vicinity of the project site are Class II bike lanes on Airport Boulevard north of Miller Avenue. The project would provide short-term and long-term bicycle parking facilities on site to meet the requirements of South San Francisco municipal code. The project would not remove any bicycle facilities, nor would it conflict with the City’s Bicycle and Pedestrian Master Plans. Thus, the project would have no significant impact on bicycle facilities. Transit Facilities Existing transit service to the study area is provided by Caltrain, Bay Area Rapid Transit (BART), Water Emergency Transit Agency (WETA), San Mateo County Transit District (SamTrans) and commuter shuttles. The project site is located less than one-quarter mile from the Caltrain station. Caltrain provides commuter rail service between San Francisco and Gilroy. The South San Francisco Caltrain Station serves local and limited-stop trains with 40 to 60-minute headways during weekdays. The project is located one-quarter mile from the South San Francisco Caltrain station. The recently reconstructed South San Francisco Caltrain station provides passengers access to the downtown from the station’s center platform via ramps connecting to the newly constructed tunnel underneath the Caltrain tracks. The tunnel connects to a pedestrian plaza at Grand Avenue/Airport Boulevard on the west side of the tracks and a transit plaza at the intersection of Grand Avenue and Poletti Way on the east side of the tracks. Buses and shuttles pick up and drop off Caltrain passengers from the new east-side plaza instead of the parking lot on the west side of the station, which results in time savings for passengers commuting to the City’s biotech job center on the east side of the tracks. Combined with the Caltrain Electrification project, the reconstructed station is expected to see increased service levels, which has been included in Caltrain planning. 800 Dubuque Avenue – Transportation Analysis 4 | Page The two BART stations closest to the project area are the San Bruno Station and the South San Francisco Station. Both stations are located within 3 miles of the project site. The Genesis One Tower Place shuttle (OTP) operated by commute.org provides service between the South San Francisco Caltrain station and the South San Francisco BART station. The OTP shuttle operates along Dubuque Avenue and currently has a stop on the southern end of the project site. With the proposed redevelopment, the shuttle stop would be facilitated on site along the drop-off zone that would be provided on the north side of the project site via the north driveway (see Figure 2). WETA provides weekday commuter ferry service between Oakland/Alameda ferry terminals and the South San Francisco Ferry Terminal at Oyster Point. The South San Francisco Ferry terminal is located approximately 2.5 miles from the project site. Shuttle service is provided between the South San Francisco ferry terminal and the Caltrain station. SamTrans provides bus service primarily on the west side of US 101. The closest bus stops to the project site are approximately 0.5 miles to the west at the intersection of Airport Boulevard and Linden Avenue and are served by Routes 292 and 397. Recently, SamTrans has extended service to the East of 101 Area via Route 130. The closest bus stop served by Route 130 is located at the Gateway Boulevard/Corporate Drive intersection, which is approximately 1 mile from the project site. Commuter shuttles provide weekday commute connections between the Caltrain station and BART, the WETA ferry terminal, and local employers in the East of 101 Area. All shuttles are wheelchair-accessible and equipped with a bicycle rack on the front of the vehicle. The new transit plaza at the intersection of Grand Avenue and Poletti Way, on the east side of the Caltrain tracks, provides a direct pedestrian connection between the Caltrain station and the following shuttle services: the Genesis One Tower Place (OTP) shuttle, the Oyster Point Caltrain (OPC) shuttle, the Utah-Grand Caltrain (UGC) shuttle, and the Oyster Point Ferry (OPF) shuttle. The project is expected to add a substantial number of new transit riders. However, with reduced transit ridership following COVID-19 pandemic, and the number of different services available (Caltrain, SamTrans busses, shuttles to the BART and ferry stations), it is anticipated that substantial new ridership could be accommodated. The project would not produce a detrimental impact to local transit or shuttle service. The project would therefore have no significant impact on transit service. Safety (Sight Distance) The site driveways were evaluated to determine whether vehicles exiting the site would have adequate sight distance to see bicycles or motor vehicles traveling on Dubuque Avenue. The minimum acceptable sight distance is what the CA MUTCD has defined as stopping sight distance. Sight distance requirements vary depending on roadway speeds. For Dubuque Avenue, which has a posted speed limit of 30 mph, the stopping sight distance is 250 feet for motor vehicles (based on a design speed of 35 mph). Accordingly, a driver must be able to see 250 feet along Dubuque Avenue to be able to avoid a collision with other vehicles. Factors that can affect sight distance are geometric features such as horizontal and vertical curves in the road, or line-of-sight obstructions like on-street parking, landscaping, and signs. Providing the appropriate sight distance reduces the likelihood of a collision at a driveway or intersection and provides drivers with the ability to exit a driveway or locate sufficient gaps in traffic. Based on observations conducted in the field, it appears that there would be adequate sight distance for drivers exiting the project site looking right to the north on Dubuque Avenue at both driveways. The project will remove all existing sign boards near the proposed driveways. However, for drivers exiting the project site to travel south on Dubuque Avenue, it appears that there would be inadequate sight distance looking left to the south on Dubuque Avenue due to a slight horizontal curve and line-of-sight obstructions. The line-of-sight obstructions include utility poles, landscaping, sign boards and the metal fence on the south side of the project site (see Figure 3). The project proposes to underground approximately 462 linear feet of electrical line along the project’s frontage on Dubuque Avenue and clear all line-of sight obstructions along the project’s frontage on 800 Dubuque Avenue – Transportation Analysis 5 | Page Dubuque Avenue. The project shall demonstrate to the satisfaction of the City that the sight distance is adequate at both project driveways, which could include the following measures. x The applicant shall coordinate with the City to decrease the speed limit on Dubuque Avenue to 25 mph. x The applicant shall coordinate with the City to remove line-of-sight obstructions (vegetation and sign boards) within the City’s right of way to the south of the project. x The applicant shall coordinate with the adjacent property of 720 Dubuque Avenue/PG&E easement to push back the existing metal fence on the southern border of the project site and remove vegetation to provide a clear zone on the corner of 720 Dubuque Avenue/PG&E easement and the project’s southern driveway. With the provision adequate sight distance at both project driveways, the project’s impact on safety would be reduced to less than significant. Emergency and Truck Access Emergency access was evaluated to determine whether the project would provide adequate vehicular ingress and egress to the project site, and a viable route to and through the project site. A review of the preliminary fire access plan prepared by Perkins & Will shows that adequate access would be provided for emergency vehicles to the site. The project site would be served by two driveways, one that would be located along the northern perimeter and the other that would be located along the southern perimeter of the project site. The two driveways would loop around the project site (see Figure 2) to provide vehicular circulation along the entire perimeter of the project site. The plan shows that the perimeter road would be at least 26 feet wide which would be adequate to facilitate fire apparatus ingress/egress and would be located 15 to 30 feet from outer edge of the building. The site plan shows that the project would provide a drop-off zone on the north side of the project for passenger loading in front of the west building that would be accessible via the north driveway. A truck loading area is proposed for the west building on the south side that can be accessed via the southern driveway, and a combined truck loading area is proposed for the north and the south buildings on the east end of the project site that can be accessed via both driveways. The site plan shows trash enclosures for all three buildings adjacent to the truck loading areas. Hexagon reviewed the truck turning templates prepared by BKF engineers for a WB-40 truck and a front- loading garbage truck (ACX64) as these vehicles would enter and exit the site. The turning templates showed that these vehicles would be able to navigate through the site to and from the loading dock and the trash collection areas without obstruction. Since the trash enclosures would be located next to the loading areas, adequate clearance would be provided for garbage trucks to empty the bins over the truck. Since garbage collection would occur on-site, along the perimeter road, traffic operations would not be affected along Dubuque Avenue. The proposed project would not reroute or change any of the City streets in its vicinity that would impact emergency vehicle access to properties along Dubuque Avenue. The proposed site access roadways would accommodate emergency vehicles. Thus, the project would not result in any emergency vehicle access impact that would be considered significant. 800 Dubuque Avenue - CEQA Transportation AnalysisFigure 1Proposed Pedestrian and Bicycle AccessLEGENDLEGEND Ɣűǁ ƔA B CD E ű F ɼGABCDEHHFGIIH 800 Dubuque Avenue - CEQA Transportation AnalysisFigure 2Proposed Vehicular AccessLEGENDLEGEND ű ADA DROP-OFFSHUTTLE DROP-OFFADA DROP-OFFSHUTTLEDROP-OFFCALTRAIN TRACKSDUBUQUE AVENUE ɼ űE Ɣűǁ ƔAAɼ ɼCBCB Ȃȃ& 02BDED 800 Dubuque Avenue - CEQA Transportation AnalysisFigure 3Field Visit - Sight DistanceSight Distance for a Driver Exiting the Southern Driveway looking Left onto Dubuque AvenueSight Distance for a Driver Exiting the NorthernDriveway looking Left onto Dubuque Avenue 800 Dubuque Avenue - CEQA Transportation AnalysisFigure 4Clear Sight TrianglesClear Sight Triangle Looking Left - North Dwy Clear Sight Triangle Looking Left - South Dwy